98% Calcitonin Salmon Cas 47931-85-1 Salmon Calcitonin Acetate 10 Mg/Bottle What is Calcitonin Salmon? Calcitonin salmon, a calcium regulating hormone, is a dual-action ......
Product Information Name:Calcitonin Acetate(Salmon) Cas No: 47931-85-1 Formula: C145H240N44O48S2 Molecular: 3431.85 Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP Purity:98% Appearance: white powder Source: synthet...
...: N-[4-(5-methyl-3-phenyl-1,2-oxazol-4-yl)benzenesulfonyl]propanamide sodium hydride Product description Parecoxib Sodium(198470-85-8) has been supplied to well-known enterprises at home and abroad on an exp...
Aluminum Calcium AlCa65% 75% 85% master alloy ingot / granules Ca: 65% 75% 85% or customized Al balance Other alloys: AlZr,AlV,AlY,AlZn, AlTi,AlB,AlMn, AlEr,AlLa,AlCe, AlFe,......
CAS No. 25154-85-2 Vinyl Chloride Resin MP60 Used In Automobile Engineering Coatings Specifications: Item Unit Index Appearance / White powder Rotational Viscosity mpa.s 6010 Chlorine 441 Volatilization ...
Test Propionate 100mg Packaging Labels Boxes With 99% Pure Powders CAS No:57-85-2 The product we are suppying 1. lables and boxes 2. 99% pure powders 3. vials with caps and stoppers 4. oral bottles 5. oral lab...
Boceprevir Intermediate 3 Chemical Name: 3-Amino-3-cyclobutylmethyl-2-hydroxypropionamide Cas No.:101968-85-8 Purity:98% min...
Rubber Auxiliary Agent Rubber Accelerator TBzTD CAS NO: 10591-85-2 Structure: Molecular Formula: C30H28S4N2 Molecular Weight: 544 CAS NO: 10591-85-2 Specification: Properties: Application: Developed to replace ...
... highly reactive hydroxyls. Trimethylolethane Product Name Trimethylolethane CAS No 77-85-0 Molecular Formula C5H12O3 Molecular Weight 120.15 Introduction Trimethylolethane (TME) is a unique multifunctional ...
Best Price Transglutaminase Enzyme ANALYSIS SPECIFICATION Appearance White Powder Activity of enzyme 90-120U/g Loss on drying 8% Heavy metals (as Pb) 2.0mg/kg Heavy metals (as As) 2.0mg/kg Microbiology Total...
Product Name: D-phenothrin Cas No. 26046-85-5 Application: Pharma Grade Appearance: pale yellow liquid Assay: min 93% Acidity: <0.1% Water content: <0.5%...
pure natural Catechin hydrate CAS No.: 7295-85-4,Green tea extract Catechinic acid 90% Product Name:Green tea Extract Main components: Catechinic acid Extraction origin: tea leaves Specification: 90% Color: Whi...
1. Quick Details Name (S)-Ethyl 2-(1-(2-phenylacetyl)pyrrolidine-2-carboxamido)acetate CAS No. 157115-85-0 EINECS No. 1592732-453-0 MF C17H22N2O4 Molecular Weight 318.37 Purity 99% Type Pharmaceutical Intermedi...
Original Japan NSK Spherical Roller Bearing 22217 CC/W33 NSK Self-aligning Roller Bearings 22217 CA/W33 Spherical roller bearings have barrel-shaped rollers between the inner ring, which has two raceways, and t...
Main Products BMK PMK CAS 20320-59-6 BMK oil CAS 5413-05-8 BMK powder CAS 5449-12-7 BMK Glycidic Acid CAS 28578-16-7 PMK ethyl glycidate oil/powder Bromine CAS 1451-82-7 2-bromo-4-methylpropiophenone CAS 1451-8...
Lithium Battery 1,2-Dimethoxypropane CAS 7778-85-0 It can be used as aprotic solvent, coupling agent and Lithium Battery additives. Product Name Vinylene Carbonate; 1,3-Dioxol-2-one CAS No. 7778-85-0 MF C5H12O2...
Hot Selling ingection peptides Ipamorelin CAS 170851-70-4 Large quantity in stock product Description Ipamorelin CAS 170851-70-4.The chemical formula is C38H49N9O5 ,EINECS NO 227-005-2. Molecular weight is 711....
85% High-quality Baicalin Extract The Root of Baicalin Extract For Cosmetics CAS 21967-41-9 Product Description Product name: 85% Baicalin Extract CAS No.: 21967-41-9 Specification : 85 % Function: Antibacteria...
Food Additive Nutritional Health Supplement White Powder L-Glutamine Food Additive Nutritional Supplement L-Glutamine Basic Information: Chemical Name: L-Glutamine CAS No.: 56-85-9 EINEC NO.: 200-292-1 Molecula...
Friendly Links: www.everychina.com
Home| Products| Suppliers| Quality Suppliers| Site Map |About Us |Contact Us |Help |关于我们 |联系我们