Sign In | Join Free | My burrillandco.com
burrillandco.com
Products
Search by Category
Home > Chemicals > Chemical Product Agents >

Fat Burning Peptides

fat burning peptides

All fat burning peptides wholesalers & fat burning peptides manufacturers come from members. We doesn't provide fat burning peptides products or service, please contact them directly and verify their companies info carefully.

Total 2580 products from fat burning peptides Manufactures & Suppliers
Buy cheap  product

Brand Name:Fulu

Model Number:57773-63-4

Place of Origin:China

57773-63-4 Fat Burning Growth Hormone Peptides HGH Fragment 176-191 Quick Details Fragments 176-191 Name : HGH Fragment 176-191 Fragments 176-191 CAS : 57773-63-4 Fragments 176-191...

SuZhou FuLu Biotech Co.,Ltd
Verified Supplier

Jiangsu

Buy cheap  product

Brand Name:YIHAN

Model Number:Hexarelin Acetate

Place of Origin:China

99% Purity Muscle Building Steroids Peptide Powder Hexarelin Acetate Quick Detail: Product Name:Hexarelin Acetate Molecular formula: C47H58N12O6 Molar Mass: 887.04022 CAS number: 1...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Buy cheap  product

Brand Name:LSW

Model Number:221231-10-3

Place of Origin:China

Safe Medical AOD 9604 HGH Fragment 177 191 Fat Burning Peptides Bodybuilding AOD9604 is based on a small part of the human growth hormone molecule. This hormone, which occurs natur...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Buy cheap  product

Brand Name:Kafen

Model Number:qualified

Place of Origin:Guangdong

Rebuild Body Tissue Fat Burning Peptides 5 Mg / Vial Selank To Lose Stubborn Fat 1 . Quick Details: Product Name:Selank Sequence: Thr-Lys-PRO-Arg-PRO-Gly-PRO Purity: 99% Appearance...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:NJBN STEROID

Model Number:158861-67-7

Place of Origin:MADE IN CHINA

GHRP-2 Acetate Fat Burning Human Growth Peptides CAS 158861-67​ --- Basic Information ---Product NameGHRP-2AliasGHRP-2 Acetate ; (DES-ALA3)-GROWTH E-RELEASING PEPTIDE-2SynonymsPRAL...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier

Jiangsu

Buy cheap  product

Brand Name:YC

Model Number:140703-51-1

Place of Origin:China

Factory Direct Supply Human Growth Hormone Peptide Hexarelin For Bodybuilding CAS 140703-51-1 Quick Details: * Product name: Hexarelin * CAS No.: 140703-51-1 * Grade: Pharmaceutica...

Wuhan Yuancheng Technology Development Co., Ltd.
Verified Supplier

Hubei

Buy cheap  product

Brand Name:YUANYANG

Model Number:CAS: 170851-70-4

Place of Origin:CHINA

Muscle Mass Gaining Peptide Ipamorelin (2mg/Vial) Basic Details: Product Name: Ipamorelin CAS: 170851-70-4 MF: C38H49N9O5 MW: 711.85296 Appearance: White Lyophilized Powder Method ...

Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:anabolic-oral steroids

Model Number:Hexarelin

Place of Origin:China

Gain Mass Muscle Hexarelin 2mg/vial Growth Hormone Peptides Steroids Hexarelin Quick Details Product Name:HexarelinSynonyms:HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

Lyophilized Powder CJC-1295 Peptide Growth Hormone CJC 1295 W/O DAC Fat Loss 1. What is CJC 1295 CJC 1295 is an injectable peptide used to increase GH production. This peptide is a...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Buy cheap  product

Model Number:99%

Place of Origin:China

Peptides Steroid Powder 2mg/vial CJC-1295 With DAC for Muscle Mass Gain CJC-1295 DAC is a long-acting version of GHRH (Growth Hormone Releasing Hormone) which has had its half-life...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hongkong

Buy cheap  product

Brand Name:LSW

Model Number:946870-92-4

Place of Origin:China

...Fat Burning Peptide Lean Muscle Building IGF-1 LR3 1mg/vial Description: Long arginine 3-IGF-1, abbreviated as IGF-1 LR3 ......

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Buy cheap  product

Brand Name:HKYC

Model Number:steroid raw

Place of Origin:HUBEI,CHINA

...Follistatin 344 Peptides Steroids Follistatin-315 Fat Burning Peptide For Bodybuildier​ Follistatin is fascinating protein that can increase muscle mass beyond natural potential...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Buy cheap  product

Brand Name:Biopro

Model Number:GHP-30

Place of Origin:China

... Hormone Releasing Peptide , Fat Burning Peptides Bodybuilding AOD 9604 AOD9604 is based on a small part of the human growth hormone molecule. This hormone, which occurs natural...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

Buy cheap  product

Brand Name:Biofriend

Model Number:140703-51-1

Place of Origin:Wuhan

...Hexarelin Examorelin Fat Burning Peptides , Human Growth Hormone Peptide for Weight Loss Quick Details: * Product name: Hexarelin/ Examorelin * Synonyms: L-lysinamide, L-histidy...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:Nanjian

Model Number:221231-10-3

Place of Origin:China

...Fat burning Peptide steroids powder AOD - 9604 Lyophilized HGH Fragment 177-191 98% CAS: 221231-10-3 for muscle ......

Tai'an Jia Ye Biological Technology Co.,Ltd
Verified Supplier

Buy cheap  product

Brand Name:JNJG

Model Number:22123265

Place of Origin:CHINA

...White Powder Adipotide Fat Burning Peptides 2mg / Vial For Weight Loss , 99% Assay Adipotide Quick Detail: Product Name: Adipotide Adipotide Molecular ......

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Buy cheap  product

Brand Name:wumeitech

Model Number:Follistatin 344

Place of Origin:China

...Body Fat Burning Peptide Powders For Sexual Follistatin 344 Polypeptides Follistatin-315 Product Name:Follistatin 344 Follistatin 344 Alias:......

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:HUAO

Model Number:863288-34-0

Place of Origin:China

...2mg Vial CJC - 1295 Human Growth Peptides , Fat Burning Peptides CAS 863288 - 34 - 0 Core Tip:CJC-1295 DAC and CJC-1295 are both Growth Hormone ......

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:owen.steroid

Model Number:Lyophilized Powder In Vials / Pure Raw Powder No Vial

Place of Origin:China

...Pharmaceutical Lean Muscle Fat Burning Peptides Hgh Fragment 176 191 5mg 2mg 10mg​ Product Details: Product Name HGH Fragment 176-191 ......

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:Kafen

Model Number:qualified

Place of Origin:Guangdong

...Rebuild Body Tissue Fat Burning Peptides 5 Mg / Vial Selank To Lose Stubborn Fat 1 . Quick Details: Product Name:Selank Sequence: Thr-Lys-PRO-Arg-PRO-Gly-PRO Purity: 99% ......

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:Pharmagrade Steroids

Model Number:863288-34-0

Place of Origin:China

...CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 Product Descripition: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl...

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Hubei

Buy cheap  product

Brand Name:JNJG

Model Number:140703-51-1

Place of Origin:CHINA

...Guarantee Quality Peptides Hexarelin Acetate 2mg 140703-51-1 for Fat Burning Hexarelin Specification: Product Name Hexarelin Hexarelin Alias Hexarelin Acetate Hexarelin CAS 1407...

Jinan  Jiage  Biological Technology Co.,Ltd
Verified Supplier

Shandong

Buy cheap  product

Brand Name:JCJ

Model Number:Cas No.: 79561-22-1

Place of Origin:China

...): 98%min. Appearance : White powder Single Impurity(HPLC): 1.0%max Amino Acid Composition: ±10% of theoretical Peptide Content(N%): ≥80.0% Water Content(Karl Fischer): ≤8.0% Ac...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:Bodybuilding

Model Number:57773-63-4

Place of Origin:China

...2mg/Vial Fat Burning Peptide H-GH Fragments 176-191 for Weight Loss Pass Custom Safely Safely Pass Customs Safely Pass ......

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Buy cheap  product

Brand Name:nanjian

Model Number:2mg/Vial

Place of Origin:China

...fat Loss Powder Peptide China supplier Cjc-1295 DAC CJC-1295 DAC has shown some amazing results as a hormone ......

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Buy cheap  product

Brand Name:YUANYANG

Model Number:CAS: 170851-70-4

Place of Origin:CHINA

...-4 MF: C38H49N9O5 MW: 711.85296 Appearance: White Lyophilized Powder Method of Analysis: HPLC Storage: Lyophilized peptides although stable at room temperature for 3 months, sho...

Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:www.steroidaily.com

Model Number:221231-10-3

Place of Origin:China

...2mg/Vial Fat Burning Peptide HGH Fragment 176-191 for Muscle Growthing Fragments 176-191 details: Name: 176-191 CAS: ......

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap  product

Model Number:99%

Place of Origin:China

... half-life extended to 8 days. This is convenient as it means the product only needs peptide injection once or twice per week for continuously elevated levels of HGH and IGF-1. ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hongkong

Buy cheap  product

Brand Name:Fulu

Model Number:57773-63-4

Place of Origin:China

...57773-63-4 Fat Burning Growth Hormone Peptides HGH Fragment 176-191 Quick Details Fragments 176-191 Name : HGH Fragment 176-191 Fragments ......

SuZhou FuLu Biotech Co.,Ltd
Verified Supplier

Jiangsu

Buy cheap  product

Brand Name:HongKong Blue Universal Co., Limited.

Model Number:51753-57-2

Place of Origin:China

...Releasing Hormone Peptides Cjc - 1295 With Dac Polypeptides For Fat Burning 1.Quick Details: Contact info. ---skype: mabel_3566;Email : mabel@sinosteroids.com Product Name---Cjc...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request