Sign In | Join Free | My burrillandco.com
burrillandco.com
Products
Search by Category
Home > Chemicals >

High Polymers

High Polymers

All High Polymers wholesalers & High Polymers manufacturers come from members. We doesn't provide High Polymers products or service, please contact them directly and verify their companies info carefully.

Total 2578 products from High Polymers Manufactures & Suppliers
Buy cheap Isoprenaline Hydrochloride Oral Anabolic Steroids CAS 51-30-9 Adrenoceptor Raw Drug from Wholesalers

Brand Name:Shuangbojie

Model Number:51-30-9

Place of Origin:China

Isoprenaline Hydrochloride CAS 51-30-9 Oral Anabolic Steroids Adrenoceptor Raw Drug Quick Details: Product name:Isoprenaline hydrochloride English Synonyms: 2-benzenediol,4-(1-hydroxy-2-((1-methylethy...

Zhuhai Shuangbojie Technology Co.,Ltd
Verified Supplier

Guangdong

Buy cheap DSIP 2mg Delta Sleep Inducing Peptide For Bodybuilding Mass Muscle from Wholesalers

Brand Name:BestSteroid

Model Number:2mg

Place of Origin:Hubei,China

Growth Hormone Peptides DSIP 2mg Powder Delta Sleep Inducing Peptide DSIP Basic Info Name: DSIP Alias Delta Sleep Inducing Peptide CAS 62568-57-4 Sequence TRP-ALA-GLY-GLY-ASP-ALA-SER-GLY-GLU MF ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Buy cheap Alumina Catalyst Support , Activated Alumina Balls As Desiccant / Fluoride / Adsorbent from Wholesalers

Brand Name:Jiulong

Model Number:Jiulong-ACT-13

Place of Origin:China

Alumina Catalyst Support , Activated Alumina Balls As Desiccant / Fluoride / Adsorbent 1. Activated alumina catalyst is widely used in petrochemical hydrogenation,dehydrogenation, and reorganization ...

Zibo  Jiulong  Chemical  Co.,Ltd
Verified Supplier

Shandong

Buy cheap Medical SARMS RAD140 Powder , Muscle Building Supplements 118237-47-0 from Wholesalers

Brand Name:Huao (trustful@ycgmp.com)

Model Number:118237-47-0

Place of Origin:China

RAD140 SARMS Raw Powder For Muscles Gaining and Lean Muscles RAD140 Quick Details: RAD140 Product name : RAD140 RAD140 CAS Number : 118237-47-0 RAD140 MW : 393.826 RAD140 MF : C20H16ClN5O2 RAD140 ...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Buy cheap white powder 2 mg/vial  Peptide CJC 1295 Without DAC for muscle building 863288-34-0 from Wholesalers

Brand Name:JNJG

Model Number:863288-34-0

Place of Origin:CHINA

GHRH Human Growth Hormone Anabolic Steroid Peptides CJC 1295 Without DAC 2 mg/vial 863288-34-0 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; CJC-1295 Acetate;CJC1295 with out DAC CAS NO ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Buy cheap High Effect Clonazolam White Crystalline Powder Formula C22H25FN4O2 Standard from Wholesalers

Brand Name:CY

Model Number:research

Place of Origin:Hebei

high effect Clonazolam Clonazolam Clonazolam powder with good quality basic information of Clonazolam CAS: 731232-23-1 Formula: C22H25FN4O2 Molecular weight 396.460 Compound purity: > 99.7% Appearance...

Chiyang Biological Technology Co., Limited
Verified Supplier

Hebei

Buy cheap A5 Plastic Melamine Dinnerware Melamine Moulding Compound Food Grade Raw Material from Wholesalers

Brand Name:Yuyao Shunji

Model Number:7008

Place of Origin:Yuyao

A5 Plastic Melamine Dinnerware Melamine Moulding Compound Food Grade Raw Material Physical Property: Melamine moulding powder is based on melamine-formaldehyde resins fortified with high-class ...

Yuyao Shunji Plastics Co., Ltd
Verified Supplier

Zhejiang

Buy cheap TC5011 Electric Building Cranes Tower qtz63 30m Free Standing Height from Wholesalers

Brand Name:HYCM

Model Number:QTZ63(5011) Tower Crane

Place of Origin:China

TC5011 Electric Building Cranes Tower qtz63 30m Free Standing Height Description 1. Equipped with all kinds of safety devices, including height limiter, radius limiter, load moment limiter, weight ...

Jinan Huiyou Construction Machinery Co., Ltd-HYCM Tower Crane
Site Member

Shandong

Buy cheap Adrenergic Blocker Tolazoline Hydrochloride CAS 59-97-2 Raws Orally Pills from Wholesalers

Brand Name:Shuangbojie

Model Number:nutrition@chembj.com

Place of Origin:China

Adrenergic Blocker Tolazoline Hydrochloride CAS 59-97-2 Raws Orally Pills Product Name: Tolazoline hydrochloride Synonyms: BENZIDAZOL HYDROCHLORIDE;BENZAZOLINE HYDROCHLORIDE;2-BENZYL-4,5-IMIDAZOLINE ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Buy cheap Mesterolone Raw Material Steroids White Powder For Male Enhancers Use Cas No 1424-00-6 from Wholesalers

Brand Name:Hongkong Saichuang

Model Number:Steroids

Place of Origin:Hubei China

Good quality Mesterolone raw material steroids white powder for male enhancers use cas no 1424-00-6 Specifications Molecular Formula: C20H32O2 Molecular weight: 304.47 CAS NO. : 1424-00-6 Synonyms: ...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

Buy cheap Top Quality Sex Hormone Powder Finasteride for Male Enhancement CAS 98319-26-7 from Wholesalers

Brand Name:HZ

Model Number:CAS:98319-26-7

Place of Origin:China

Top Quality Sex Hormone Powder Finasteride for Male Enhancement Basic Info. Product Name Finasteride Finasteride Synonyms Proscar Finasteride CAS 98319-26-7 Finasteride MF C23H36N2O2 Finasteride MW ...

Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
Verified Supplier

Hubei

Buy cheap 99% Trenbolone Steroid Hormone Powder Tibolone Acetate CAS 5630-53-5 from Wholesalers

Brand Name:Yuancheng

Model Number:5630-53-5

Place of Origin:Wuhan,Hubei

99% Trenbolone Steroid Hormone Powder Tibolone Acetate CAS 5630-53-5 CAS: 5630-53-5 EINECS: 227-069-1 Assay: 99% min. MF: C21H28O2 MW: 312.45 Character: White powder. MP: 169°C Livial/Liviella is used ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Buy cheap EDOT Electronic Grade Chemicals CAS 77214-82-5 Orange To Brown Powder from Wholesalers

Brand Name:BeiLi

Model Number:ITX.99A.K

Place of Origin:China

EDOT Electronic Grade Chemicals CAS 77214-82-5 Orange To Brown Powder Description Iron(III) p-toluenesulfonate, also known as Iron(III) p-toluenesulfonate hexahydrate, its appearance was orange to ...

BeiLi Chemicals (Zhangjiagang) Co., Ltd.
Verified Supplier

Jiangsu

Buy cheap CJC -1295 Without DAC Peptide Hormones Muscle Building CAS 863288-34-0 from Wholesalers

Brand Name:Pharmagrade Steroids

Model Number:863288-34-0

Place of Origin:China

High Purity Peptide CJC-1295 Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building Product Descripition: CAS 863288-34-0 Appearance White Powder MF C152H252N44O42 MW 3367.2 Assay >99.5% Single ...

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Buy cheap Tiletamine Hydrochloride HCL olazepam hcl Telazol Powder CAS 14176-50-2 Veterinary Tranquilizer from Wholesalers

Brand Name:GC

Model Number:14176-50-2

Place of Origin:China

Quick Detail: Product Name: Tiletamine hydrochloride CAS :14176-50-2 Synonyms:TILETAMINE HYDROCHLORIDE (200 MG);Cyclohexanone, 2-(ethylamino)-2-(2-thienyl)-, hydrochloride;TILETAMINE HYDROCHLORIDE);CI...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Buy cheap Clomiphine Citrate Antiestrogen Steroids 50-41-9 Sex Drugs Male Anti Estrogen Clomid from Wholesalers

Place of Origin:WuHan

Brand Name:YC

Model Number:C32H36ClNO8

Clomiphine Citrate Boldenone Steroids 50-41-9 Sex Drugs Male Anti Estrogen Clomid Powder Quick Detail: Clomifene Citrate Another name: Clomid; 2-4-[2-Chloro-1, 2-diphenylethenyl]phenoxy-N, N...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Buy cheap 35% White Cationic Rosin Size Emulsion Paper Industry Internal Paper Sizing Agent from Wholesalers

Brand Name:LANSEN - Cationic Rosin Size emuslion

Model Number:LSR-35 - Cationic Rosin Size emuslion

Place of Origin:China

35% White Cationic Rosin Size emuslion for Paper Industry Internal Sizing Product Description: The cationic rosin size is made with the international advanced technique of high-pressure homogenization...

Wuxi Tianxin Chemical Co.,Ltd
Verified Supplier

Jiangsu

Buy cheap Medium Temp Alpha Amylase Enzyme for Pad Steam Desizing with Optimal Stength Retention from Wholesalers

Brand Name:XIANHUA BIO CHEMICAL

Model Number:Enzy WT-A

Place of Origin:Shanghai, China (Mainland)

Medium Temp Alpha Amylase Enzyme for Pad Steam Desizing with Optimal Stength Retention Introduction: It is a concentrated thermo stable bacterial amylase which should be used as a formulating base for ...

XIANHUA (SHANGHAI) BIO CHEMICAL CO.,LTD.
Verified Supplier

Shanghai

Buy cheap Jeep Compass Decorate a Strip 1CH95WSZAB/1CH94WSZAB/1CH92WSZAB/1CH93WSZAB,White from Wholesalers

Brand Name:JOLUNG

Model Number:1CH95WSZAB/1CH94WSZAB/1CH92WSZAB/1CH93WSZAB

Place of Origin:CHANGHOU JIANGSU CHINA

Quick Details Place of Origin: Jiangsu, China (Mainland) Brand Name: JOLUNG Model Number: JY-BA-007 Product name: Jeep Compass Decorate a Strip Car model: JEEP COMPASS OEM: 1CH95WSZAB/1CH94WSZAB...

CHANGZHOU JIULONG AUTO LAMP FACTORY
Active Member

Jiangsu

Buy cheap Soft soap (Potassium soap)Lubricant for Chain Conveyer from Wholesalers

Brand Name:Runsheng

Place of Origin:China

Email: Sales2@tjrunsheng.com skype: willa-1208 Product Name: Soft soap/Potassium Soap Soft soap is yellowish white, yellowish brown or yellowish green; transparent or translucent, uniform, slimy soft ...

Tianjin Runsheng Cellulose Science and Technology Co., Ltd.
Active Member

Tianjin

Go to Page
Inquiry Cart 0