Sign In | Join Free | My burrillandco.com
Home > Machinery > Environmental Machinery > Noise Reduction Device >

Shipyard 33db Noise Reduction Ear Plugs

1-10 Results for

shipyard 33db noise reduction ear plugs

from 13 Products

Shipyard 33dB NRR Waterproof Noise Reduction Ear Plugs ANSI AS NZS

China Shipyard 33dB NRR Waterproof Noise Reduction Ear Plugs ANSI AS NZS on sale
... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come with alternative sizes. A proper size forms a...
JIAXING FUXING IMP. AND EXP. CO.,LTD

Address: Room 301,No.555 ChuangYe Road,Jiashan county,Zhejiang,Province

PU Plastic Soft Ear Plugs , Noise Reduction Ear Plugs Super Flexibility

China PU Plastic Soft Ear Plugs , Noise Reduction Ear Plugs Super Flexibility on sale
Description The Noise Ear Plugs realize the function to reduce work, home, sleep and safety noise. Due to the washable and reusable design, it is really friendly to the environment. As a matter of fact, it can be an ideal facility used for airplanes, ......
CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.

Address: No. 398, Middle Tongjiang Road, Xinbei District, Changzhou City, Jiangsu Province

FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design

China FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design on sale
...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam for the best fit and low ontact pressure. 3. Good inner space for ear......
FUTURE TECH LIMITED

Address: 210, No.328, LongPing East Road, Longgang Street,Longgang District, 518116 Shenzhen city ,China

Soft Silicone Corded Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff

China Soft Silicone Corded Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff on sale
...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs......
Sweet Home International(H.K.)Limited

Address: Gulin,Ningbo,China

Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone

China Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone on sale
Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone Product description Descreption. 1. 3.5mm Stereo plug 2. In ear type, Dual ear with MIC and refined MIC housing 3. high quality speaker, Hi-Fi sound quality 4. Stereo earphone with noise......
Earlisten Electronic Co ., Ltd

Address: 4F Building 2, Feihuangda Shitoushan Industrial ,Shiyan Town ,Bao'an District ,Shenzhen,China

Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone

China Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone on sale
Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone Product description Descreption. 1. 3.5mm Stereo plug 2. In ear type, Dual ear with MIC and refined MIC housing 3. high quality speaker, Hi-Fi sound quality 4. Stereo earphone with noise......
Earlisten Electronic Co ., Ltd

Address: 4F Building 2, Feihuangda Shitoushan Industrial ,Shiyan Town ,Bao'an District ,Shenzhen,China

Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

China Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs on sale
... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-......
Anhui Uniform Trading Co.Ltd

Address: No. 3, Qiaowan Road, Feixi Economic Development Zone, Hefei City, Anhui Pro. (231200), China

Multi Color Wired In Ear Earphones Flat Cable 1.2 MM Noise Cancelling Earbuds Factory

China Multi Color Wired In Ear Earphones Flat Cable 1.2 MM Noise Cancelling Earbuds Factory on sale
...Ear Earphones Wired Earphone Information Item Number 3404-FY148 Communication Wired Earphone Color Multi color Plug 3.5mm straight plug Cable Flat cable Flat Cable Specification Impedance 24Ω±5Ω Speaker size 10MM Cable length 120CM Frequency range 20Hz-20KHz Sensitivity 100dB±5dB Max power input 10mW Feature High quality sound insulation Passive noise reduction......
Guangzhou Huayi Electronic Factory

Address: Romm 1101, No.21,Songyuanzhongxi Street, Pingsha, Baiyun Distrct, Guangzhou,Guangdong Province, China

50mm Onikuma K8 Noise Cancelling Gaming Headphones

China 50mm Onikuma K8 Noise Cancelling Gaming Headphones on sale
...Ear Headphones with Volume Control LED Light Cool Style Stereo Noise Reduction Earphone features: Compatibility: With 3. 5mm audio cable jack (USB jack just work for LED light), wired stereo sound over ear gaming headset supports PC, Xbox One Controller(has 3. 5mm plug......
Shenzhen Ouni Technology Co.,Ltd

Address: Room A502, Jisheng Bldg, #1049 Minzhi Street, Longhua District

Titanium Film Horn Noise Cancelling Microphone Earbuds

China Titanium Film Horn Noise Cancelling Microphone Earbuds on sale
... deep bass sound Noise reduction function can be enabled in a variety of states, including Bluetooth on or off, plug-in state Soft protein memory foam ear pads with large ear cups provide comfortable wearing Metal stretchable arm, rotatable and foldable,...
Golden Promise Industrial Mfg.Co.,Ltd.

Address: Unit 27, 5/F, Shing Yip Ind. Bldg, 19 - 21 Shing Yip Street, Kwun Tong, Kowloon, H.K.

Submit your shipyard 33db noise reduction ear plugs inquiry in a minute :
*From:
Your email address is incorrect!
To:

Golden Promise Industrial Mfg.Co.,Ltd.

Products: Titanium Film Horn Noise Cancelling Microphone Earbuds

*Subject:
Your subject must be between 10-255 characters!
*Message:
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000 characters!
 
Please reply me within 24 hours.
Yes! I would like your verified suppliers matching service!
Yes! If this supplier doesn't contact me in 3 days, I want everychina.com to recommend me more suppliers.
Submit shipyard 33db noise reduction ear plugs inquiry
*From:
Your email address is incorrect!
*Subject:
Your subject must be between 10-255 characters!
*Message:
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000
Yes! I would like your verified suppliers matching service!