Home > Consumer Electronic > Earphone & Headphone & Accessories > Earphones & Headphones >

Ear Plug Noise Reduction

Fair Trading Service

Report fraud supplier Report IPR Products

Haven't found right suppliers
Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
And this service is free of charge.
we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!

Submit Buying Request

Total 9395 products for ear plug noise reduction Manufacture & Suppliers

Airline Travel Noise Cancelling Ear Plugs , Reusable Ear Plugs For Swimming

Airline Travel Noise Cancelling Ear Plugs , Reusable Ear Plugs For Swimming Specifications: Product name Airline Travel Noise Cancelling Ear Plugs , Reusable Ear Plugs For Swimming Shape Tree shape Material of ...

Hangzhou Shengyi Tourist Novelty Co., Ltd.
Zhejiang,China

Verified Supplier

Add to cart
Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-......

Anhui Uniform Trading Co.Ltd
Anhui,China

Verified Supplier

Add to cart
Soft PU Foam Disposable Ear Plugs Slow Rebounded Noise Cancelling Ear Plugs with Box

PU Foam Disposable Earplugs Slow Rebounded Noise Cancelling Soft Ear Plugs with Box Specifications: Product name PU Foam Disposable Earplugs Slow Rebounded Soft Noise Cancelling Ear Plugs with Box Shape Bullet ...

Hangzhou Shengyi Tourist Novelty Co., Ltd.
Zhejiang,China

Verified Supplier

Add to cart
Waterproof Safety Foam Ear Plugs 26.4dB 23.6inch 60cm Reusable Noise Cancelling Ear Plugs

... to break, reusable and can be cleaned. 6 Colors: The package contains 30 pairs of corded ear plugs in various colors including light blue, black, pink, green, orange and yellow, enough for your daily use; T...

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
Safety Silicone Reusable Ear Plugs Slow Rebounded PU Foam Ear Plugs

... is soft and comfortable to wear, the cord is made of nylon, which is strong and not easy to break down Design of shape The ear plugs look like Christmas tree, can fit your ears easily, they are soft and com...

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
Safety Silicone Reusable Ear Plugs For Personal Hearing Proctection

... is soft and comfortable to wear, the cord is made of nylon, which is strong and not easy to break down Design of shape The ear plugs look like Christmas tree, can fit your ears easily, they are soft and com...

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
Customized Logo Portable Noise Blocking Ear Plugs For Air Flight

Customized Logo Portable Noise Blocking Ear Plugs For Air Flight Specifications: Product name Customized Logo Portable Noise Blocking Ear Plugs For Air Flight Shape Bullet Material of earplug PU foam or customi...

Hangzhou Shengyi Tourist Novelty Co., Ltd.
Zhejiang,China

Verified Supplier

Add to cart
PU Foam Reusable 30db Soft Ear Plugs With Cord Slow Rebound

...Ear Plugs, 100 Pair, Ear Plugs for Sleeping, Snoring, Loud Noise, Traveling, Concerts, Construction, & Studying HEARING PROTECTION: for Sleeping, Loud Noise, Concerts, Construction, Heavy Machinery, Music, a...

JIAXING FUXING IMP. AND EXP. CO.,LTD
Zhejiang,China

Active Member

Add to cart
Leather Waterproof Headphone Ear Pads Thickness 2cm Noise Reduction

...Noise Reduction Product Description: Headphone Earpads provide excellent noise reduction and comfort for users. It comes with multi-color choice, such as black, to fit with different preferences. The round s...

Dongguan Kerui Automation Technology Co., Ltd
Guangdong,China

Verified Supplier

Add to cart
FT-FM-9001B-E High Noise Canceling Earmuffs Passive Noise Reduction Design 29dB

...Roofer, Linesman and Vulcan Helmet. 3. Good inner space for ear. 4.With CE, ANIS, AS/NZS standard. Direction of Use Pull the cups outward and position the hearing protector over your ears so that the cushion...

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...

Earlisten Electronic Co ., Ltd
Guangdong,China

Active Member

Add to cart
Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...

Earlisten Electronic Co ., Ltd
Guangdong,China

Verified Supplier

Add to cart
Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...

Earlisten Electronic Co ., Ltd
Guangdong,China

Verified Supplier

Add to cart
Various Size Anti - Noise Ear Plugs , Silicone Ear Plugs For Sports

Various Sound Proof Ear Plugs Customized On Shape / Box / Color / Size Specifications: Product name Various Sound Proof Ear Plugs Customized On Shape / Box / Color / Size Shape Bullet / Cylinder / Tree-like, Tr...

Hangzhou Shengyi Tourist Novelty Co., Ltd.
Zhejiang,China

Verified Supplier

Add to cart
TWS Full Range Noise Reduction JL V40 In Ear Wireless Earphones

..., TWS smart headphones will play an important role in the fields of wireless connection, voice interaction, intelligent noise reduction, health monitoring, and hearing enhancement/protection. It is not only ...

Shenzhen Hosing Technology Development Co., Ltd.
Guangdong,China

Verified Supplier

Add to cart