Home > Consumer Electronic > Earphone & Headphone & Accessories > Earphones & Headphones >

Foam In Ear

Fair Trading Service

Report fraud supplier Report IPR Products

Haven't found right suppliers
Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
And this service is free of charge.
we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!

Submit Buying Request

Total 518 products for foam in ear Manufacture & Suppliers

PU protein leather ear pad blue colour accessories for the headphone wired earphones blue tooth headphone

... build-up during intense gaming sessions . Memory foam comfortably fits the unique shape of every individual's heads . Ice silk lycra provides heat transfer with faster sweat evoportaion . OEM /ODM manufactu...

LUCKY GREAT INDUSTRY (HONG KONG ) LIMITED
Guangdong,China

Site Member

Add to cart
PU protein leather ear cushion brown colour accessories for the headphone wired earphones blue tooth headphone

... build-up during intense gaming sessions . Memory foam comfortably fits the unique shape of every individual's heads . Ice silk lycra provides heat transfer with faster sweat evoportaion . OEM /ODM manufactu...

LUCKY GREAT INDUSTRY (HONG KONG ) LIMITED
Guangdong,China

Site Member

Add to cart
football mesh ear cushion green color for the accessories headphone wired earphones blue tooth headphone

...ear pad for the headphone . Materials : Top layer - Ice silk lycra /PU leather /football mesh inside - memory foam outer - PU leather /football mesh bottom - mesh Advantage : Cooling gel layer reduces heat b...

LUCKY GREAT INDUSTRY (HONG KONG ) LIMITED
Guangdong,China

Site Member

Add to cart
PU protein leather ear cushion black color for the accessories headphone wired earphones blue tooth headphone

...ear pad for the headphone . Materials : Top layer - Ice silk lycra /PU leather /football mesh inside - memory foam outer - PU leather /football mesh bottom - mesh Advantage : Cooling gel layer reduces heat b...

LUCKY GREAT INDUSTRY (HONG KONG ) LIMITED
Guangdong,China

Site Member

Add to cart
Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound ti...

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Jiangsu,China

Verified Supplier

Add to cart
Customized Color Soft Ear Plugs , PU Material Noise Cancelling Earplugs

...Foam polyurethane earplug features bullet-shape, which is designed for people with normal ear canal, it is soft, flexible and features a slow deformation, which can change the earplug shape according to the ...

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Jiangsu,China

Verified Supplier

Add to cart
EM115 Impact-Resistant Soft Foam Pad Safety Earmuffs Industry ABS Construction

... foam filter Earmuff NRR 27dB Size suit for adlut,easy to adjust Color Black,red,blue or others Function Reduce the noise to protect the ear MOQ 1000PCS Production capacity 100000pcs/month Packing one pc per...

Ningbo Welwork Ppe Co., Ltd.
Zhejiang,China

Verified Supplier

Add to cart
Child Universal High Density Foam Head Immobilize For Spind Board Stretcher

... Allowed, High Density Foam 3) Material:High Density Foam 4) Certificate:ISO9001/13485;CE;FDA 5) Manufacturer Description: Head Immobilize is made of high-density foam, large ear holes for monitoring the pat...

Zhangjiagang New Fellow Med Co., Ltd.
Jiangsu,China

Verified Supplier

Add to cart
Universal Waterproof Foam Head Immobilize For Spind Board Stretcher

... Allowed, High Density Foam 3) Material:High Density Foam 4) Certificate:ISO9001/13485;CE;FDA 5) Manufacturer Description: Head Immobilize is made of high-density foam, large ear holes for monitoring the pat...

Zhangjiagang New Fellow Med Co., Ltd.
Jiangsu,China

Verified Supplier

Add to cart
51cm - 62cm Foam Head Guard Tkd Use Martial Arts Training Equipment

... martial artists. Provides fuller coverage on top of head and Macho's signature ear-release canals for ear protection. Designed specifically for taekwondo sparring, this high-quality 7/8" foam headgear featu...

Qingdao Hongde New Material Co., Ltd
Shandong,China

Site Member

Add to cart
Sound Proof Ear Plugs Yellow Color , Swimming Ear Plugs Waterproof 2.4*1.3CM Size

Sound Proof Ear Plugs Yellow Color , Swimming Ear Plugs Waterproof 2.4*1.3CM Size Specifications: Product name Sound Proof Ear Plugs Yellow Color , Swimming Ear Plugs Waterproof 2.4*1.3CM Size Shape Bullet Mate...

Hangzhou Shengyi Tourist Novelty Co., Ltd.
Zhejiang,China

Verified Supplier

Add to cart
Lightweight Memory Foam Eye Mask With Ear Plugs / Adjustable Strap

1, Product Name: Sleep Eye Mask Cover with Ear Plugs, Light Blocking Memory Foam Eye Mask with Adjustable Strap for Sleeping/Shift Work �� ELIMINATE EYE FATIGUE: Unique contoured eliminate eye fatigue, which has...

Shenzhen D-Jeesian Bags Co., Ltd.
Guangdong,China

Active Member

Add to cart
Acrylic Earring Display Stand White Jewellery Stand Rack with 4 Tiers for Drop Earring

Acrylic Earring Display Stand White Jewellery Stand Rack with 4 Tiers for Drop Earring Specification: Material Acrylic Model No. GMT Earring Display-0012 Size 380*70*390mm Color White Logo Customized Packing on...

Good Meta Display (HK) Co.,Ltd
Guangdong,China

Active Member

Add to cart
Medical Dual Head Stethoscope With Foam Inside Packaging And Manual Size Of 18.6X10.8cm

...Ear tips:PVC soft ear tips (Kindcare patented ear tips) Binaural:stainless steel with chromed finishes Y-tube:PVC Y-tubing length: around 55.8cm Total length of the product:around 71cm Chest piece: stainless...

MIANYANG XIANFENG MEDECAL INSTRUMENT CO.,LTD
Sichuan,China

Verified Supplier

Add to cart
Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-......

Anhui Uniform Trading Co.Ltd
Anhui,China

Verified Supplier

Add to cart

|< << 1 2 3 4 5 6 7 8 9 10 >> >|

Inquiry Cart 0

All Categories

Foam In Ear

Total 518 products for foam in ear Manufacture & Suppliers

PU protein leather ear pad blue colour accessories for the headphone wired earphones blue tooth headphone

PU protein leather ear cushion brown colour accessories for the headphone wired earphones blue tooth headphone

football mesh ear cushion green color for the accessories headphone wired earphones blue tooth headphone

PU protein leather ear cushion black color for the accessories headphone wired earphones blue tooth headphone

Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction

Customized Color Soft Ear Plugs , PU Material Noise Cancelling Earplugs

EM115 Impact-Resistant Soft Foam Pad Safety Earmuffs Industry ABS Construction

Child Universal High Density Foam Head Immobilize For Spind Board Stretcher

Universal Waterproof Foam Head Immobilize For Spind Board Stretcher

51cm - 62cm Foam Head Guard Tkd Use Martial Arts Training Equipment

Sound Proof Ear Plugs Yellow Color , Swimming Ear Plugs Waterproof 2.4*1.3CM Size

Lightweight Memory Foam Eye Mask With Ear Plugs / Adjustable Strap

Acrylic Earring Display Stand White Jewellery Stand Rack with 4 Tiers for Drop Earring

Medical Dual Head Stethoscope With Foam Inside Packaging And Manual Size Of 18.6X10.8cm

Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs