Home > Consumer Electronic > Earphone & Headphone & Accessories > Earphones & Headphones >

Noise Reducing Ear Muffs

Fair Trading Service

Report fraud supplier Report IPR Products

Haven't found right suppliers
Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
And this service is free of charge.
we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!

Submit Buying Request

Total 12201 products for noise reducing ear muffs Manufacture & Suppliers

Adjustable Headband EM110 ANSI Approved Safety Earmuffs for Industrial Noise Reduction

... foam filter Earmuff NRR 27dB Size suit for adlut,easy to adjust Color Black,red,blue or others Function Reduce the noise to protect the ear MOQ 1000PCS Production capacity 100000pcs/month Packing one pc per...

Ningbo Welwork Ppe Co., Ltd.
Zhejiang,China

Verified Supplier

Add to cart
EM112 Lemon Safety Earmuffs ANSI Approved for Noise Cancellation Adjustable Headband

... foam filter Earmuff NRR 26dB Size suit for adlut,easy to adjust Color Black,red,blue or others Function Reduce the noise to protect the ear MOQ 1000PCS Production capacity 100000pcs/month Packing one pc per...

Ningbo Welwork Ppe Co., Ltd.
Zhejiang,China

Verified Supplier

Add to cart
EM119 ANSI Foldable Metal Headband Safety Earmuffs Top Choice for Noise Protection

... filter Earmuff NRR 26dB Size suit for adlut,easy to adjust Color Black,yellow,red,blue or others Function Reduce the noise to protect the ear MOQ 1000PCS Production capacity 100000pcs/month Packing one pc p...

Ningbo Welwork Ppe Co., Ltd.
Zhejiang,China

Verified Supplier

Add to cart
EM122 ANSI AS/NZS Safety Earmuffs Optimal Noise Reduction for Industrial Environments

... foam filter Earmuff NRR 34dB Size suit for adlut,easy to adjust Color Black,red,blue or others Function Reduce the noise to protect the ear MOQ 1000PCS Production capacity 100000pcs/month Packing one pc per...

Ningbo Welwork Ppe Co., Ltd.
Zhejiang,China

Verified Supplier

Add to cart
EM124 CE EN352 ANSI AS/NZS Approval 31dB Industry Safety Earmuffs for Noise Reduction

... foam filter Earmuff NRR 28dB Size suit for adlut,easy to adjust Color Black,red,blue or others Function Reduce the noise to protect the ear MOQ 1000PCS Production capacity 100000pcs/month Packing one pc per...

Ningbo Welwork Ppe Co., Ltd.
Zhejiang,China

Verified Supplier

Add to cart
Swimming Noise Cancelling Corded Disposable Ear Plugs OEM ODM

...Adults Ear Plugs for Swimming, Snoring,Travel, Work,Nightlife,with Portable Boxes Ear Plugs noise canceling, It is an ideal choice for your life and work; These multi-use earplugs ensure to protect your hear...

JIAXING FUXING IMP. AND EXP. CO.,LTD
Zhejiang,China

Active Member

Add to cart
Stainless Steel 304/316 Coupling Female Thread Muffs For Pipe Connection Forged Coupling

...r 20 years. Our flagship products include Pipes, Flanges, Fittings like Bends, Elbows, Tees, Reducers, Caps, forged fittings, Bolt and nuts, Gaskets, Profiles etc conforming to all Nationally & International...

TOBO STEEL GROUP CHINA
Shanghai,China

Verified Supplier

Add to cart
40mm Speaker Active Noise Cancelling Earphones Over Ear Headphones HiFi Deep Bass Soft Protein Ear Cups Foldable

...Noise Cancelling ANC Headphones Over Ear Headphones HiFi Deep Bass Soft Protein Ear Cups Foldable Active Noise Cancelling Headphones Wireless Over Ear Bluetooth ANC Headphones Hi-Res Deep Bass Memory Foam Ea...

Guangzhou Huayi Electronic Factory
Guangdong,China

Active Member

Add to cart
40mm Speaker Active Noise Cancelling Earphones Over Ear Headphones HiFi Deep Bass Soft Protein Ear Cups Foldable

...Noise Cancelling ANC Headphones Over Ear Headphones HiFi Deep Bass Soft Protein Ear Cups Foldable Active Noise Cancelling Headphones Wireless Over Ear Bluetooth ANC Headphones Hi-Res Deep Bass Memory Foam Ea...

Guangzhou Huayi Electronic Factory
Guangdong,China

Verified Supplier

Add to cart
Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-......

Anhui Uniform Trading Co.Ltd
Anhui,China

Verified Supplier

Add to cart
38dB SNR 31dB NRR Noise Dampening Foam Ear Plugs 12*7*24mm

...Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU Foam (Latex free and PVC free); Slow rebound foam material fits different ear canal structures and have no pressure on ear Hig...

JIAXING FUXING IMP. AND EXP. CO.,LTD
Zhejiang,China

Active Member

Add to cart
Over Ear Active Noise Cancelling Headphones Bluetooth ANC Headphones Customizable

... headphones use microphones and special circuitry to create sound waves that cancel out or "neutralize" the incoming noise, allowing the listener to enjoy their audio content without interference f...

Shenzhen OCMC Technology Co., Ltd
Guangdong,China

Verified Supplier

Add to cart
Over Ear Active Noise Cancelling Headphones Bluetooth ANC Headphones Customizable

... headphones use microphones and special circuitry to create sound waves that cancel out or "neutralize" the incoming noise, allowing the listener to enjoy their audio content without interference f...

Shenzhen OCMC Technology Co., Ltd
Guangdong,China

Verified Supplier

Add to cart
Over Ear Active Noise Cancelling Headphones Bluetooth ANC Headphones Customizable

... headphones use microphones and special circuitry to create sound waves that cancel out or "neutralize" the incoming noise, allowing the listener to enjoy their audio content without interference f...

Shenzhen OCMC Technology Co., Ltd
Guangdong,China

Verified Supplier

Add to cart
TELIKOU NE-11 | Super Light Single Ear Headset Male Five PIn Intercom Muff Dynamic or Electret Microphone Clearcom

Product Description Hello thank you to choose our NE-11 single ear intercom headset it is widely used in different industry it is used very convenient , and have very high quality . this headset is our new desi...

Telikou Technologies Co., Ltd.
Beijing,China

Verified Supplier

Add to cart
New Arrival Microphone Wireless Invisible Hearing Aid In Ear Earphones Hidden Mini Amplifier

...Ear cap * 6 sets 6.Charging line * 1 7. Packing box * 1 * AVAILBLE DURATION-Comparing with the morden hearing aid,this hearing aid is made of HD digital intelligent chip can be used for a long time. * REDUCI...

Saferlife Products Co., Ltd.
China

Verified Supplier

Add to cart
AS 24db Foam Ear Plugs Soft Noise Reduction Reusable Earplugs For Sleeping

...Ear Plugs for personal hearing proctection Description of Reusable Ear plugs : Material The ear plugs are made of silicone, which is soft and comfortable to wear, the cord is made of nylon, which is strong a...

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
Noise Reduction Safety Ear Plugs For Personal Hearing Proctection

... is soft and comfortable to wear, the cord is made of nylon, which is strong and not easy to break down Design of shape The ear plugs look like Christmas tree, can fit your ears easily, they are soft and com...

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
Over Ear Waterproof Wireless Headphones Noise Cancelling 3 . 7V 370mAh Battery

... wireless transmission function,adopted CSR8635 chip for realizing more stable connection,farther distance of transmission as well as excellent sound quality. 3 . Noise cancelling specially use 40mm drivers,...

Earlisten Electronic Co ., Ltd
Guangdong,China

Active Member

Add to cart

|< << 8 9 10 11 12 13 14 15 16 >> >|

Inquiry Cart 0

All Categories

Noise Reducing Ear Muffs

Total 12201 products for noise reducing ear muffs Manufacture & Suppliers

Adjustable Headband EM110 ANSI Approved Safety Earmuffs for Industrial Noise Reduction

EM112 Lemon Safety Earmuffs ANSI Approved for Noise Cancellation Adjustable Headband

EM119 ANSI Foldable Metal Headband Safety Earmuffs Top Choice for Noise Protection

EM122 ANSI AS/NZS Safety Earmuffs Optimal Noise Reduction for Industrial Environments

EM124 CE EN352 ANSI AS/NZS Approval 31dB Industry Safety Earmuffs for Noise Reduction

Swimming Noise Cancelling Corded Disposable Ear Plugs OEM ODM

Stainless Steel 304/316 Coupling Female Thread Muffs For Pipe Connection Forged Coupling

40mm Speaker Active Noise Cancelling Earphones Over Ear Headphones HiFi Deep Bass Soft Protein Ear Cups Foldable

40mm Speaker Active Noise Cancelling Earphones Over Ear Headphones HiFi Deep Bass Soft Protein Ear Cups Foldable

Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

38dB SNR 31dB NRR Noise Dampening Foam Ear Plugs 12724mm

Over Ear Active Noise Cancelling Headphones Bluetooth ANC Headphones Customizable

Over Ear Active Noise Cancelling Headphones Bluetooth ANC Headphones Customizable

Over Ear Active Noise Cancelling Headphones Bluetooth ANC Headphones Customizable

TELIKOU NE-11 | Super Light Single Ear Headset Male Five PIn Intercom Muff Dynamic or Electret Microphone Clearcom

New Arrival Microphone Wireless Invisible Hearing Aid In Ear Earphones Hidden Mini Amplifier

AS 24db Foam Ear Plugs Soft Noise Reduction Reusable Earplugs For Sleeping

Noise Reduction Safety Ear Plugs For Personal Hearing Proctection

Over Ear Waterproof Wireless Headphones Noise Cancelling 3 . 7V 370mAh Battery