Sign In | Join Free | My burrillandco.com

For Buyers
For Suppliers
- Search Suppliers
- Privacy Policy
Inquiry Basket(0)

All Categories

Home > Consumer Electronic > Earphone & Headphone & Accessories > Earphones & Headphones >

Sound Noise Reduction

Fair Trading Service

Report fraud supplier Report IPR Products

Haven't found right suppliers
Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
And this service is free of charge.
we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!

Submit Buying Request

Total 12162 products for sound noise reduction Manufacture & Suppliers

G1000 2021 Latest Wired Noise Reduction Headset

...Noise Reduction Headset Product Specifications item value Certification other Is wireless Yes Wireless Type Other Support Memory Card No Vocalism Principle Other Volume Control No Control Button Yes Codecs A...

shenzhen tengshengda ELECTRIC CO., LTD.
Guangdong,China

Active Member

Add to cart
Self Adhesive Rubber Weather Stripping Noise Reduction Epdm Foam Strip

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dus...

Sichuan Jiayueda Building Materials Co., Ltd.
Sichuan,China

Active Member

Add to cart
Black Mesh Office Chair With Wheels Conference Room Chair Noise Reduction

... choosing different colors for the mesh fabric, frame, or other components, allowing users to personalize their chairs to match their preferences or office decor. 2.Noise Reduction: The mesh material used in...

Guangdong Esun Furniture Technology Company Limited
China

Active Member

Add to cart
Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ......

Anhui Uniform Trading Co.Ltd
Anhui,China

Verified Supplier

Add to cart
FT-FM-3E ABS Material Earmuffs with 32dB SNR and Passive Noise Reduction for Industrial Safety

FT-FM-3E high noise canceling earmuffs passive noise reduction design 32dB Product Advantage: New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech a...

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
FT-FM-9001B-E Cap-Mounted Earmuffs with 29dB SNR Noise Reduction and ABS Material for Industrial Safety

FT-FM-9001B-E high noise canceling earmuffs passive noise reduction design Product Advantage: Helmet mounted earmuff are part of the centurion connect range. It is compatible with Miner, Roofer, Linesman and Vu...

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
HUAWEI WATCH Buds Earphone SmartWatch 2-in-1 Noise Reduction Call Blood Oxygen Monitoring Men Women Sports Bracelet

... Come into One | AI Noise Cancellation Calling | Professional Health Managem Nimble Pop-up Cover The pop-up cover opens with a gentle nudge, made possible by the precise rotating ......

Hunan Jenet Communications Equipment Co., Ltd.
Hunan,China

Active Member

Add to cart
Micro-perforated Acoustic Panel Elegant Solution for Noise Reduction

...Noise Reduction Description: The micro-perforated acoustic panel offers a high-performance acoustic solution that merges practicality with stylish aesthetics. Featuring front-facing micro holes (0.4 to 1mm) ...

Guangzhou Wuyang Yiguan Acoustic Materials Co., Ltd.
China

Verified Supplier

Add to cart
Machine Rooms Industrial Noise Reduction Solutions Carbon Steel Noise Control Panels

...

Changzhou Jingyuan Noise Controlling Material Co.,Ltd.
Jiangsu,China

Verified Supplier

Add to cart
Durable Car Wiper Accessories Noise Reduction Replacement Wiper Blade Weather Resistant

..., trucks, and SUVs. Engineered with high-quality plastic materials, these wiper accessories provide optimal visibility in all weather conditions while offering noise-free performance. Key Features Universal ...

xiamen dufei automotive parts Co.,ltd
Shaanxi,China

Verified Supplier

Add to cart
Soundproof Office Pod with Built-in Ventilation System, Noise Reduction up to 50 Decibels, and Customizable Size

...open-plan offices, gardens, shopping malls, and video conferences. This modern prefab modular capsule house offers exceptional privacy and noise isolation. Transform any workspace with our premium Soundproof...

Guangzhou Yinke Technology Co., Ltd.
Guangdong,China

Verified Supplier

Add to cart
DuPont Molykote EM-D 110 Grease for Plastic Gears & Driveshaft Spline Noise Reduction

...Spline Noise Reduction Molykote® EM-D110 is a high-viscosity PAO-based grease with lithium soap thickener, specifically designed for plastic components. It appears as a white grease with NLGI grade 0-1, sili...

Shenzhen Huazhisheng New Material Technology Co., Ltd.
Guangdong,China

Verified Supplier

Add to cart
Egr Cooler Mesh Silver Knitted Wire Gauze M12 M14 Knitted Wire Mesh Gasket For Noise Reduction

... Gasket For Noise Reduction Knitted Wire Gauze Feature High strength and stability. High filtration efficiency. Good shielding performance. Corrosion and rust resistance. Durable and long service life. what ...

AnPing ZhaoTong Metals Netting Co.,Ltd
Hebei,China

Verified Supplier

Add to cart
Noise Reduction Soundproofing Materials Blanket for Outdoor Noise Barrier Materials

#detail_decorate_root .magic-0{margin-bottom:10px;overflow:hidden}#detail_decorate_root .magic-1{border-bottom-style:solid;border-bottom-color:#53647a;font-family:Roboto;font-size:24px;color:#53647a;font-style:...

Guangzhou Mq Acoustic Materials Co., Ltd
China

Verified Supplier

Add to cart
Acoustic Wooden Slat Panels With Luxurious Suede Finish For Sound Absorption And Noise Reduction

Product Introduction These acoustic panels, which combine suede and MDF materials, are meticulously designed to impart a luxurious ambiance to any room, be it a bedroom, living room, or other spaces. They not o...

Guangzhou Mq Acoustic Materials Co., Ltd
China

Verified Supplier

Add to cart
Customizable 3D Acoustic Panel for Noise Reduction and Aesthetic Enhancement

...m high-quality, eco-friendly materials to deliver exceptional sound management without compromising on aesthetics. The intricate three-dimensional designs not only absorb unwanted noise but also serve as str...

Guangzhou Mq Acoustic Materials Co., Ltd
China

Verified Supplier

Add to cart
Noise Reduction Polyester Fiber Acoustic Panel for Interior Ceiling Soundproofing PET Felt

... fiber, these panels absorb unwanted sound, reduce reverberation, and add a touch of contemporary style to your ceilings. Product Name Polyester Fiber Acoustic Panel Application Ceilings Panel ......

Guangzhou Mq Acoustic Materials Co., Ltd
China

Verified Supplier

Add to cart
Wholesale Acoustic Panels Polyester Fiber Noise Reduction PET Acoustic Board for Ceiling

...thermally-bonded polyester fibers (often from recycled PET), they absorb excess sound energy where it hits your walls—turning echo and noise into calm and clarity. Product Name Polyester Fiber Acoustic Panel...

Guangzhou Mq Acoustic Materials Co., Ltd
China

Verified Supplier

Add to cart
Soundproofing Acoustic Panel Engineered To Deliver Superior Noise Reduction In Busy Environments

... noise blocking, and the Class B fire rating adds protection. Third-party tests show typical rooms — from busy offices to loud restaurants — can see RT60 drop by as much as 40%. Custom engraving turns sound ...

Guangzhou Mq Acoustic Materials Co., Ltd
China

Verified Supplier

Add to cart
Fire Resistant Polyester Fiber Acoustic Panel Providing Noise Reduction For Workspaces

... while the substrate addresses noise problems. NRC 0.85 reduces low-frequency rumble from HVAC systems. Class B fire rated. Sound-absorbing PET construction. Straightforward adhesive installation. Product Sp...

Guangzhou Mq Acoustic Materials Co., Ltd
China

Verified Supplier

Add to cart

|< << 21 22 23 24 25 26 27 28 29 >> >|

Inquiry Cart 0

Friendly Links: www.everychina.com

Home| Products| Suppliers| Site Map |About Us |Contact Us |Help |关于我们 |联系我们

Copyright © 2009 - 2026 burrillandco.com. All rights reserved.