Home > Consumer Electronic > Earphone & Headphone & Accessories > Earphones & Headphones >

Foam For Noise Reduction

Fair Trading Service

Report fraud supplier Report IPR Products

Haven't found right suppliers
Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
And this service is free of charge.
we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!

Submit Buying Request

Total 8403 products for foam for noise reduction Manufacture & Suppliers

Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...

Earlisten Electronic Co ., Ltd
Guangdong,China

Verified Supplier

Add to cart
Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ......

Anhui Uniform Trading Co.Ltd
Anhui,China

Verified Supplier

Add to cart
3mm Thick Eva Foam Underlayment 200sqft/Roll Vinyl Tile Noise Reduction Underlay

... overcome the minor subfloor imperfections and insulate the noise EVA underlay has a variety of applications. They can be used under Engineered wood floor, Luxury Vinyl tile, SPC tile and plank floorings and...

Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Jiangsu,China

Site Member

Add to cart
77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor

Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weathe...

Starking Shutter Manufacturer Limited
China

Verified Supplier

Add to cart
NOISE REDUCTION HEADPHONE #ANC-J3

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal sta...

Shenzhen Bowei Electronics Co.,Ltd.
Guangdong,China

Active Member

Add to cart
NOISE REDUCTION HEADPHONE #ANC-J1

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal sta...

Shenzhen Bowei Electronics Co.,Ltd.
Guangdong,China

Active Member

Add to cart
Self Adhesive Rubber Weather Stripping Noise Reduction Epdm Foam Strip

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dus...

Sichuan Jiayueda Building Materials Co., Ltd.
Sichuan,China

Active Member

Add to cart
32mm Thickness Aluminium Foil Underlay Anti Crush Vapor Proofing Noise Reduction

...Foam aluminum foil Underlay For Laminate Floor noise reduction Introduction: EVA (Ethylene-Vinyl Acetate) Underlayment is designed for using under floated laminate, bamboo and engineered wood floors and is i...

Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Jiangsu,China

Site Member

Add to cart
Laminate Foam Underlay Roll Noise Reduction 20KG/M3 EPE 2mm

20kg/Cbm EPE Underlay Roll Noise Reduction For Laminated Wooden Flooring 2MM EPE foam with PE FILM Overlapped EPE Underlayment for laminated wooden flooring Product descripition Our 2mm poly cell foam, moister ...

Changzhou New Top Star New Material Technology Co.,Ltd
China

Verified Supplier

Add to cart
Windproof Soundproof Epdm Foam Rubber Weather Stripping Noise Reduction

Windproof Soundproof Epdm Foam Rubber Weather Stripping Noise Reduction Product Description The flexibility of EPDM sealing strips is a key factor in their success. They can easily adapt to irregular surfaces, ...

Sichuan Jiayueda Building Materials Co., Ltd.
Sichuan,China

Active Member

Add to cart
33dB SNR Passive Noise Reduction Earmuffs with ABS Material for High Noise Canceling Protection

... speech and signals. The sealing rings are broad and filled with soft plastic foam for the best fit and low ontact pressure. Good inner space for ear. With CE standard. Direction of Use Pull the cups ......

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
Black ABS 30dB SNR Passive Noise Reduction Earmuffs for High Noise Canceling Hearing Protection

... speech and signals. The sealing rings are broad and filled with soft plastic foam for the best fit and low ontact pressure. Good inner space for ear. With CE standard. Direction of Use Pull the cups ......

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
High Noise Canceling Earmuffs with 28dB SNR Passive Noise Reduction and ABS Head Band

... speech and signals. The sealing rings are broad and filled with soft plastic foam for the best fit and low ontact pressure. Good inner space for ear. With CE standard. Direction of Use Pull the cups ......

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound ti...

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Jiangsu,China

Active Member

Add to cart
Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound ti...

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Jiangsu,China

Verified Supplier

Add to cart
FT-FM-3E ABS Material Earmuffs with 32dB SNR and Passive Noise Reduction for Industrial Safety

... speech and signals. The sealing rings are broad and filled with soft plastic foam for the best fit and low ontact pressure. Good inner space for ear. With CE standard. Direction of Use Pull the cups ......

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
Semi Open Cell Polyolefin PO Acoustic Foam with Aluminum Foil Layer and Adhesive Backing Premium Noise Reduction Insulation Boards Fire Resistant and Easy to Install for Ventilation Systems

High Performance Semi-open cell PO Foam Acoustic Foam with Aluminum Foil and Self-Adhesive Acoustic Absorption Foam -Open Cell Polyethylene Acoustic Foam - CTF Acoustic Absorption Foam is a foam product obtaine...

Cyg Tefa Co., Ltd.
Guangdong,China

Verified Supplier

Add to cart
Semi Open Cell PO Foam Black Acoustic Insulation Sheets Laminated With Aluminum Foil And Self Adhesive Base Effective Noise Reduction Heat Isolation For Air Duct Systems And General Construction

High Performance Semi-open cell PO Foam Acoustic Foam with Aluminum Foil Acoustic Absorption Foam -Open Cell Polyethylene Acoustic Foam - CTF Acoustic Absorption Foam is a foam product obtained through the proc...

Cyg Tefa Co., Ltd.
Guangdong,China

Verified Supplier

Add to cart
Semi Open Cell PO Foam Black Acoustic Insulation Sheets Laminated With Aluminum Foil And Self Adhesive Base Effective Noise Reduction Heat Isolation For Air Duct Systems And General Construction

High Performance Semi-open cell PO Foam Acoustic Foam with Aluminum Foil Acoustic Absorption Foam -Open Cell Polyethylene Acoustic Foam - CTF Acoustic Absorption Foam is a foam product obtained through the proc...

Cyg Tefa Co., Ltd.
Guangdong,China

Verified Supplier

Add to cart
Semi Open Cell Polyolefin PO Acoustic Foam with Aluminum Foil Layer and Adhesive Backing Premium Noise Reduction Insulation Boards Fire Resistant and Easy to Install for Ventilation Systems

High Performance Semi-open cell PO Foam Acoustic Foam with Aluminum Foil and Self-Adhesive Acoustic Absorption Foam -Open Cell Polyethylene Acoustic Foam - CTF Acoustic Absorption Foam is a foam product obtaine...

Cyg Tefa Co., Ltd.
Guangdong,China

Verified Supplier

Add to cart

|< << 1 2 3 4 5 6 7 8 9 10 >> >|

Inquiry Cart 0

All Categories

Foam For Noise Reduction

Total 8403 products for foam for noise reduction Manufacture & Suppliers

Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

3mm Thick Eva Foam Underlayment 200sqft/Roll Vinyl Tile Noise Reduction Underlay

77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor

NOISE REDUCTION HEADPHONE #ANC-J3

NOISE REDUCTION HEADPHONE #ANC-J1

Self Adhesive Rubber Weather Stripping Noise Reduction Epdm Foam Strip

32mm Thickness Aluminium Foil Underlay Anti Crush Vapor Proofing Noise Reduction

Laminate Foam Underlay Roll Noise Reduction 20KG/M3 EPE 2mm

Windproof Soundproof Epdm Foam Rubber Weather Stripping Noise Reduction

33dB SNR Passive Noise Reduction Earmuffs with ABS Material for High Noise Canceling Protection

Black ABS 30dB SNR Passive Noise Reduction Earmuffs for High Noise Canceling Hearing Protection

High Noise Canceling Earmuffs with 28dB SNR Passive Noise Reduction and ABS Head Band

Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction

Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction

FT-FM-3E ABS Material Earmuffs with 32dB SNR and Passive Noise Reduction for Industrial Safety

Semi Open Cell Polyolefin PO Acoustic Foam with Aluminum Foil Layer and Adhesive Backing Premium Noise Reduction Insulation Boards Fire Resistant and Easy to Install for Ventilation Systems

Semi Open Cell PO Foam Black Acoustic Insulation Sheets Laminated With Aluminum Foil And Self Adhesive Base Effective Noise Reduction Heat Isolation For Air Duct Systems And General Construction

Semi Open Cell PO Foam Black Acoustic Insulation Sheets Laminated With Aluminum Foil And Self Adhesive Base Effective Noise Reduction Heat Isolation For Air Duct Systems And General Construction

Semi Open Cell Polyolefin PO Acoustic Foam with Aluminum Foil Layer and Adhesive Backing Premium Noise Reduction Insulation Boards Fire Resistant and Easy to Install for Ventilation Systems