Home > Rubber & Plastics > Rubber Products > Other Rubber Products >

Foam For Noise Reduction

Images Search

Total 7210 products for foam for noise reduction Manufacture & Suppliers

EPDM E-4088 Black Rubber Foam Automotive Noise Reduction And Shock Proof

EPDM E-4088 Black rubber foam automotive noise reduction and shock-proof foam Material / Feature / Application : E-4088 sponge rubber has low hardness and is black in color. It has good waterproof and shock res...

SZ PUFENG PACKING MATERIAL LIMITED
Guangdong,China

Verified Supplier

Add to cart
3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction

3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical application...

Cyg Tefa Co., Ltd.
Guangdong,China

Verified Supplier

Add to cart
3mm Super EVA Foam Underlayment Noise Reduction With Blue Aluminum Film

... is designed for using under floated laminate, bamboo and engineered wood floors and is ideal for many types of sub-flooring. This underlayment is with a 3 mm thick foam layer that provides optimal cushionin...

Changzhou New Top Star New Material Technology Co.,Ltd
China

Verified Supplier

Add to cart
Blue IXPE 2mm Foam Underlay Noise Reduction Underlay For Wood Floor

...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also ...

Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Jiangsu,China

Site Member

Add to cart
10mm Polyethylene Foam Roll Material Xpe Crosslinked Pe Foam For Noice Reduction

10mm Polyethylene Foam Roll Material Xpe Crosslinked Pe Foam For Noice Reduction 10mm XPE crosslinked polyethylene foam roll is ideal for noise reduction applications. Its dense, crosslinked structure effective...

Shenzhen Eco Polyfoam Products Co., Ltd.
Guangdong,China

Verified Supplier

Add to cart
Noise Reduction Foamed Rubber Sheet Insulation Boards 1000mm 1200mm

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ......

Chongqing Haike Thermal Insulation Material Co., Ltd.
Chongqing,China

Active Member

Add to cart
Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...

Earlisten Electronic Co ., Ltd
Guangdong,China

Active Member

Add to cart
Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...

Earlisten Electronic Co ., Ltd
Guangdong,China

Verified Supplier

Add to cart
Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ......

Anhui Uniform Trading Co.Ltd
Anhui,China

Verified Supplier

Add to cart
77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor

Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weathe...

Starking Shutter Manufacturer Limited
China

Verified Supplier

Add to cart
NOISE REDUCTION HEADPHONE #ANC-J3

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal sta...

Shenzhen Bowei Electronics Co.,Ltd.
Guangdong,China

Active Member

Add to cart
Self Adhesive Rubber Weather Stripping Noise Reduction Epdm Foam Strip

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dus...

Sichuan Jiayueda Building Materials Co., Ltd.
Sichuan,China

Site Member

Add to cart
FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design

...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signa...

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound ti...

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Jiangsu,China

Active Member

Add to cart
Professional Noise Reduction Fence Soundproof Material Aluminum Sheet Metal

... reduction of roads, highways, elevated composite roads and other noise sources. It is divided into a purely sound-reflecting reflective sound barrier, and a composite sound barrier combined with sound absor...

Qingdao TaiCheng transportation facilities Co.,Ltd.
Shandong,China

Verified Supplier

Add to cart
Wireless Bass Bluetooth Headset Active Noise Reduction Headphones For Gaming Phone

... Noise Reduction Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep Bass *Product Description Type: Active Noise Cancelling Chip...

Shengpai Electronics Co,ltd
Guangdong,China

Active Member

Add to cart
Industrial Rubber Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption

Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (co...

Qingdao Huashida Machinery Co., Ltd.
Shandong,China

Verified Supplier

Add to cart
750ml High Temp Pu Foam Sealant Noise Resistant For Insulating Building Seam

750ml High Temp Pu Foam Sealant Noise Resistant For Insulating Building Seam 750ml Expanding Tube Foam Multi Purpose Construction Use Noise Resistant Description: I-Like PU Foam Sealant is made of high quality ...

SHENZHEN I-LIKE FINE CHEMICAL CO., LTD
Guangdong,China

Verified Supplier

Add to cart