Total 7192 products for foam noise reduction Manufacture & Suppliers

• Energy Saving Construction Heat Insulation Foam Noise Reduction Anti Condensation

  

  reflecting fireproof sound and heat insulation sheet materials ixpe foam for roof Closed Cell Cross Linked Rolls & Laminated Sheets Rolls, sheets and multi-layer laminated blocks manufactured from cross linked ...

  Cyg Tefa Co., Ltd.

  Guangdong,China

  Verified Supplier

  Add to cart

  Contact Supplier

• Rogers L-32 Foam Waterproof Flame Retardant Noise Reduction Polyurethane Foam

  

  ...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-...

  SZ PUFENG PACKING MATERIAL LIMITED

  Guangdong,China

  Verified Supplier

  Add to cart

  Contact Supplier

• 33kg/M3 2mm Laminate Underlay 200sqft/Roll Floor Impact Noise Reduction Underlayment

  

  ...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reductio...

  Changzhou New Top Star New Material Technology Co.,Ltd

  China

  Verified Supplier

  Add to cart

  Contact Supplier

• Blue IXPE 2mm Foam Underlay Noise Reduction Underlay For Wood Floor

  

  ...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also ...

  Jiangsu Zhongxinhe New Material Technology Co., Ltd.

  Jiangsu,China

  Site Member

  Add to cart

  Contact Supplier

• Noise Reduction Foamed Rubber Sheet Insulation Boards 1000mm 1200mm

  

  Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ......

  Chongqing Haike Thermal Insulation Material Co., Ltd.

  Chongqing,China

  Active Member

  Add to cart

  Contact Supplier

• Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

  

  ...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...

  Earlisten Electronic Co ., Ltd

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

  

  ...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...

  Earlisten Electronic Co ., Ltd

  Guangdong,China

  Verified Supplier

  Add to cart

  Contact Supplier

• Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

  

  ... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ......

  Anhui Uniform Trading Co.Ltd

  Anhui,China

  Verified Supplier

  Add to cart

  Contact Supplier

• 77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor

  

  Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weathe...

  Starking Shutter Manufacturer Limited

  China

  Verified Supplier

  Add to cart

  Contact Supplier

• NOISE REDUCTION HEADPHONE #ANC-J3

  

  ... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal sta...

  Shenzhen Bowei Electronics Co.,Ltd.

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• Self Adhesive Rubber Weather Stripping Noise Reduction Epdm Foam Strip

  

  ... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dus...

  Sichuan Jiayueda Building Materials Co., Ltd.

  Sichuan,China

  Site Member

  Add to cart

  Contact Supplier

• FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design

  

  ...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signa...

  FUTURE TECH LIMITED

  China

  Verified Supplier

  Add to cart

  Contact Supplier

• Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction

  

  ... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound ti...

  CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.

  Jiangsu,China

  Active Member

  Add to cart

  Contact Supplier

• Professional Noise Reduction Fence Soundproof Material Aluminum Sheet Metal

  

  ... reduction of roads, highways, elevated composite roads and other noise sources. It is divided into a purely sound-reflecting reflective sound barrier, and a composite sound barrier combined with sound absor...

  Qingdao TaiCheng transportation facilities Co.,Ltd.

  Shandong,China

  Verified Supplier

  Add to cart

  Contact Supplier

• Wireless Bass Bluetooth Headset Active Noise Reduction Headphones For Gaming Phone

  

  ... Noise Reduction Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep Bass *Product Description Type: Active Noise Cancelling Chip...

  Shengpai Electronics Co,ltd

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• Industrial Rubber Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption

  

  Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (co...

  Qingdao Huashida Machinery Co., Ltd.

  Shandong,China

  Verified Supplier

  Add to cart

  Contact Supplier

• Split Audiophile Bluetooth Earbuds Noise Reduction Ipx5 Waterproof

  

  ... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active noise reduction Features Immersive sound Premium speaker drivers deliver crisp, dynamic audio. Active Noise Reduction Technology ...

  Anhui Arts & Crafts Import & Export Company Ltd.

  Anhui,China

  Verified Supplier

  Add to cart

  Contact Supplier

• Wearproof Noise Reduction CR Sealed Foam For Mop Making

  

  CR Sealed Foam CR0515B Heat-Resistant And Fire Resistant For Civil Engineering Product introduction CR rubber and plastic products are new environment-friendly plastic foam materials 1,introduce CR rubber and p...

  Kunshan Honteck Electronic Material Co., Ltd

  Jiangsu,China

  Active Member

  Add to cart

  Contact Supplier