Home > Machinery > Environmental Machinery > Noise Reduction Device >

Noise Reduction Foam

Images Search

Total 10837 products for noise reduction foam Manufacture & Suppliers

Noise Reduction Foamed Rubber Sheet Insulation Boards 1000mm 1200mm

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ......

Chongqing Haike Thermal Insulation Material Co., Ltd.
Chongqing,China

Active Member

Add to cart
Interior Acoustic Foam Wall Panels Decorative Fiber Glass Noise Reduction Foam Panels

Product Details Using a combination of various inorganic materials, with inorganic materials as the main material, a special board is made by adding conductive materials such as conductive porcelain clay powder...

Guangzhou Jiansheng Acoustics Decoration Engineering Co., Ltd.
China

Verified Supplier

Add to cart
Rogers L-32 Foam Waterproof Flame Retardant Noise Reduction Polyurethane Foam

...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-...

SZ PUFENG PACKING MATERIAL LIMITED
Guangdong,China

Verified Supplier

Add to cart
Durable Silicone Foam Gasket With High Compression And Creep Resistance Ideal For Cushioning And Noise Reduction Applications

...formed by the foaming of polysiloxane, retaining the excellent properties of silicone polymers, such as resistance to high and low temperatures, ultraviolet light, ozone, weatherability, insulation, and ......

Dongguan Ziitek Electronical Material and Technology Co., Ltd
Guangdong,China

Verified Supplier

Add to cart
Eco-Friendly Polyethylene Acoustic Foam for Noise Reduction in Vehicles, Trains, and HVAC Systems

... 3510 PO Foam) is a foam product obtained through the processes of blending polyethylene with foaming agents and auxiliaries, followed by extrusion and foaming. Further processing includes laminating with al...

Cyg Tefa Co., Ltd.
Guangdong,China

Verified Supplier

Add to cart
Safety Reusable Silicone Earplugs 31.5*12.5mm with 32dB SNR Noise Reduction and Washable Design

... Silicone Foam Ear Plugs 31.5 X 12.5mm With Nylon PVC Cord Product Overview Safety silicone earplugs with nylon or PVC cord for superior ear protection in various environments. Key Features Perfect Noise Red...

FUTURE TECH LIMITED
China

Verified Supplier

Add to cart
Automatic Control Rubber Foam Insulation Tube/Sheet Production Line for Noise Reduction and Vibration Absorption with NBR/PVC/EPDM Material

...Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption Product Overview Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it ...

Qingdao Huashida Machinery Co., Ltd.
Shandong,China

Verified Supplier

Add to cart
33kg/M3 2mm Laminate Underlay 200sqft/Roll Floor Impact Noise Reduction Underlayment

...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reductio...

Changzhou New Top Star New Material Technology Co.,Ltd
China

Verified Supplier

Add to cart
EVA Floor Soundproof Film | Noise Reduction Flooring Underlayment Supplier

... comfort, and provide moisture protection for various flooring systems. Manufactured from premium Ethylene Vinyl Acetate (EVA) foam, this flooring underlay offers excellent elasticity, shock absorption, soun...

Changzhou Sponge & Rubber Products Co., Ltd
Jiangsu,China

Verified Supplier

Add to cart
Blue IXPE 2mm Foam Underlay Noise Reduction Underlay For Wood Floor

...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also ...

Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Jiangsu,China

Site Member

Add to cart
38dB SNR 31dB NRR Noise Dampening Foam Ear Plugs 12*7*24mm

...Foam Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU Foam (Latex free and PVC free); Slow rebound foam material fits different ear can...

JIAXING FUXING IMP. AND EXP. CO.,LTD
Zhejiang,China

Active Member

Add to cart
MPV Tailored Chassis Automotive Sound Barrier Insulation Noise Reduction

...vehicle, such as the doors, floor, roof, and firewall. Their strategic placement and combination can effectively minimize noise and improve overall comfort. 2,MPV cars are often used for family outings or gr...

Guangdong Jirui Acoustic Technology Co., Ltd.
Guangdong,China

Verified Supplier

Add to cart
Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...

Earlisten Electronic Co ., Ltd
Guangdong,China

Active Member

Add to cart
Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...

Earlisten Electronic Co ., Ltd
Guangdong,China

Verified Supplier

Add to cart
Knife Cutting Foam Crusher Machine Low Noise Pu Foam Shredder Machine

... noise knife cutting pulverizer This machine is mainly used for crushing sponges, cloth sponges, pea, EVA, plastics and rubber. It can be used with sponge regeneration equipment. Tdp-s-4 crusher is equipped ...

Qingdao Xinmeiteng Sponge Manufacture Co.
Shandong,China

Verified Supplier

Add to cart
Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ......

Anhui Uniform Trading Co.Ltd
Anhui,China

Verified Supplier

Add to cart
77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor

Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weathe...

Starking Shutter Manufacturer Limited
China

Verified Supplier

Add to cart
NOISE REDUCTION HEADPHONE #ANC-J3

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal sta...

Shenzhen Bowei Electronics Co.,Ltd.
Guangdong,China

Active Member

Add to cart

|< << 1 2 3 4 5 6 7 8 9 10 >> >|

Inquiry Cart 0

All Categories

Noise Reduction Foam

Total 10837 products for noise reduction foam Manufacture & Suppliers

Noise Reduction Foamed Rubber Sheet Insulation Boards 1000mm 1200mm

Interior Acoustic Foam Wall Panels Decorative Fiber Glass Noise Reduction Foam Panels

Rogers L-32 Foam Waterproof Flame Retardant Noise Reduction Polyurethane Foam

Durable Silicone Foam Gasket With High Compression And Creep Resistance Ideal For Cushioning And Noise Reduction Applications

Eco-Friendly Polyethylene Acoustic Foam for Noise Reduction in Vehicles, Trains, and HVAC Systems

Safety Reusable Silicone Earplugs 31.5*12.5mm with 32dB SNR Noise Reduction and Washable Design

Automatic Control Rubber Foam Insulation Tube/Sheet Production Line for Noise Reduction and Vibration Absorption with NBR/PVC/EPDM Material

33kg/M3 2mm Laminate Underlay 200sqft/Roll Floor Impact Noise Reduction Underlayment

EVA Floor Soundproof Film | Noise Reduction Flooring Underlayment Supplier

Blue IXPE 2mm Foam Underlay Noise Reduction Underlay For Wood Floor

38dB SNR 31dB NRR Noise Dampening Foam Ear Plugs 12724mm

MPV Tailored Chassis Automotive Sound Barrier Insulation Noise Reduction

Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

Knife Cutting Foam Crusher Machine Low Noise Pu Foam Shredder Machine

Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor

NOISE REDUCTION HEADPHONE #ANC-J3