| Sign In | Join Free | My burrillandco.com |
|
Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ......
Product Details Using a combination of various inorganic materials, with inorganic materials as the main material, a special board is made by adding conductive materials such as conductive porcelain clay powder...
...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-...
...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reductio...
3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical application...
...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also ...
...Foam Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU Foam (Latex free and PVC free); Slow rebound foam material fits different ear can...
...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...
...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...
... noise knife cutting pulverizer This machine is mainly used for crushing sponges, cloth sponges, pea, EVA, plastics and rubber. It can be used with sponge regeneration equipment. Tdp-s-4 crusher is equipped ...
... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ......
Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weathe...
... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal sta...
... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dus...
...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signa...
... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound ti...
... Noise Reduction Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep Bass *Product Description Type: Active Noise Cancelling Chip...
Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (co...