Total 5751 products for noise eliminating ear plugs Manufacture & Suppliers

• Shipyard 33dB NRR Waterproof Noise Reduction Ear Plugs ANSI AS NZS

  

  ... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come wit...

  JIAXING FUXING IMP. AND EXP. CO.,LTD

  Zhejiang,China

  Active Member

  Add to cart

  Contact Supplier

• PU Plastic Soft Ear Plugs , Noise Reduction Ear Plugs Super Flexibility

  

  ..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc. The Noise Ear Plugs come with high performance PU and Plast...

  CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.

  Jiangsu,China

  Active Member

  Add to cart

  Contact Supplier

• Waterproof Safety Foam Ear Plugs 26.4dB 23.6inch 60cm Reusable Noise Cancelling Ear Plugs

  

  ... to break, reusable and can be cleaned. 6 Colors: The package contains 30 pairs of corded ear plugs in various colors including light blue, black, pink, green, orange and yellow, enough for your daily use; T...

  FUTURE TECH LIMITED

  China

  Verified Supplier

  Add to cart

  Contact Supplier

• Flexible Shooting Ear Plugs ROHS Custom Silicone Parts

  

  ... use sealing characteristics of silicone material then designed to meet the human ear structure, a rubber ear plug can protect the eardrum by noise damage effectively. Silicone Ear Plugs are common used in e...

  Xiamen Juguangli Import & Export Co., Ltd

  Fujian,China

  Verified Supplier

  Add to cart

  Contact Supplier

• OEM Pyrex Glass Ear Plugs 13mm Stainless Steel Handmade Piercing Jewelry

  

  ... effect , handmade piercing jewelry , from 4 gauge to 1" , 13mm high , also can do other color Keywords: Ear Plug Tunnels OEM/ODM: Acceptable Piercing Plugs: Ear Plug Payment: T/T,Paypal Shipping Method: By ...

  Shenzhen Golden Moon Trade Ltd.

  China

  Active Member

  Add to cart

  Contact Supplier

• Soft Silicone Corded Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff

  

  ...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding...

  Sweet Home International(H.K.)Limited

  Zhejiang,China

  Active Member

  Add to cart

  Contact Supplier

• Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

  

  ... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-......

  Anhui Uniform Trading Co.Ltd

  Anhui,China

  Verified Supplier

  Add to cart

  Contact Supplier

• Lightweight Memory Foam Eye Mask With Ear Plugs / Adjustable Strap

  

  1, Product Name: Sleep Eye Mask Cover with Ear Plugs, Light Blocking Memory Foam Eye Mask with Adjustable Strap for Sleeping/Shift Work ��� ELIMINATE EYE FATIGUE: Unique contoured eliminate eye fatigue, which has...

  Shenzhen D-Jeesian Bags Co., Ltd.

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for Women

  

  Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for Women Product Description Product name Stud earrings Material Stainless steel Features Fine quality AAA Cubic Zirco...

  Guangzhou Pullman Jewelry Co., Ltd.

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• Pu Foam Ear Plugs

  

  Pu Foam Ear Plugs 【Description】 Sound insulation is made of PU foam, which is easy to put into your ear to keep away the noise. Each pair is packed with a easy-open plastic case. Your logo can be added on the c...

  Dishine International Limited

  Zhejiang,China

  Active Member

  Add to cart

  Contact Supplier

• Pu foam Ear plugs,Earplugs,Foam ear plugs ,CE EN 352-2 Bullet PU Foam Ear plugs

  

  Specifications -Foam earplug or silicone earplug -Metal tube with key ring,ball chain or hook. -Colour depends on need -Logo print is ok Description for earplug with metal tube: - Earplugs: PU foam earplug or s...

  YANGZHOU XINFLY AMENITIES CO.,LTD

  Jiangsu,China

  Active Member

  Add to cart

  Contact Supplier

• 300V 10A M2.5 Screw Fixed Ear Plug-In Brass Terminal Block

  

  HQ2EDGKM-5.0/5.08 mm pitch screw fixed ear plug-in type brass terminal block Pitch 5.0/5.08mm Screw M2.5.Steel.Zinc plated Wire guard Phosphor bronze.Ni plated Pin header Brass. Tin plated Rated voltage 300V Ra...

  CIXI ZHONGYI ELECTRONIC EQUIPMENT FACTORY

  Zhejiang,China

  Verified Supplier

  Add to cart

  Contact Supplier

• noise canceling ear cushion protein PU leather plus memory foam for the gaming headphone

  

  PRODUCT NAME : noise canceling ear cushion protein PU leather plus memory foam for the gaming headphone Item number :HR260519 Materials : high protein PU leather + memory foam colour : black /grey/red /orange/ ...

  LUCKY GREAT INDUSTRY (HONG KONG ) LIMITED

  Guangdong,China

  Site Member

  Add to cart

  Contact Supplier

• Sport ear plug Bluetooth earphone run headphone with hook best sellers in 2017

  

  ... plug, portability,steadiness and comfortable silica gal hook for ear. There are four fashion colors for choice,and the control buttons is on the right ear plug, this design will not be influence by the swea...

  Zhongshan Aomei Trade Co.,Ltd

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• Background Noise Elimination Wireless Signal Detector Hidden Microphone Signal Detector

  

  .... It has sensitivity adjustment, noise elimination, and can effectively distinguish whether the signal is a wireless camera or a hidden microphone (hidden microphone) or a cellular phone. When you need to us...

  Changsha Purple Horn E-Commerce Co., Ltd.

  Hunan,China

  Verified Supplier

  Add to cart

  Contact Supplier

• The Most Affordable Option for Airline Travel Noise Cancelling Ear Earphone in Many Vibrant Colors

  

  Cheapest constellation in ear earphone with many colors Product Description Frequency 20-20,000 Hz Sensitivity 104±10%DB Impedance 32±2Ω Plug 3.5mm dual PIN Speaker 10mm Length 1.2m or customized Color multi Fu...

  Yichun Yuanzhou District Heshi Electronics Co., Ltd.

  China

  Verified Supplier

  Add to cart

  Contact Supplier

• Stereo Wireless blue tooth earphone earhook bone conduction headphones No Ear Plugs Headset

  

  ...bone conduction headphones No Ear Plugs Headset with Microphone TWS earbuds wireless earbuds wireless headset sport earphone Product description: Stereo Wireless blue tooth earphone earhook bone conduction h...

  Producentre (Dongguan) Electronic Co., Ltd

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• BT5.0 EDR 20m Wireless Charging Headset 400mah Noise Elimination

  

  Hot Sale TWS Gold Airpods Pro Bluetooths Wireless Earphone Headphone Customized Logo Wireless charging function + rename function + GPS positioning function + ear detection function 1.Change Name and GPS Positi...

  Shenzhen Qianrun Trade Co., Ltd.

  Guangdong,China

  Verified Supplier

  Add to cart

  Contact Supplier