Total 24114 products for noise reduction ear protection Manufacture & Suppliers

• Shipyard 33dB NRR Waterproof Noise Reduction Ear Plugs ANSI AS NZS

  

  ... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come wit...

  JIAXING FUXING IMP. AND EXP. CO.,LTD

  Zhejiang,China

  Active Member

  Add to cart

  Contact Supplier

• ANSI Z87.1 Certified Noise Reduction Ear Muff with ABS Material for Baby and Workplace Safety

  

  ...Ear Protection Earmuff Description of Soundpfoof Ear Muffs : Fit to ear Human body leather material, comfortable experience,reduce pressure on the ear,fit the face. Comfortable to wear Simple and fashionable...

  FUTURE TECH LIMITED

  China

  Verified Supplier

  Add to cart

  Contact Supplier

• Wired Over Ear gaming Headphone Noise reduction ear pads and DC jack USB connector for PS4

  

  Product Description Product name Wired Over Ear gaming Headphone Noise reduction ear pads and DC jack USB connector for PS4 Material ABS, Aluminium or customized material. Color refer to the pictures in site or...

  Producentre (Dongguan) Electronic Co., Ltd

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• 5mm Polyester Fiber Board Walls Decorative Noise Reduction Fire Protection

  

  ...Noise Reduction Fire Protection Wall Panel Pet Felt 100% Polyester Fibre Acoustic Panel Product type Polyester fiber panel/PET sound absorbing panel Product specification Chromatic PET panels:1220*2420*9/12m...

  Chengdu Yixing Amber Decoration Design Co., Ltd.

  Sichuan,China

  Verified Supplier

  Add to cart

  Contact Supplier

• PU Plastic Soft Ear Plugs , Noise Reduction Ear Plugs Super Flexibility

  

  ..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc. The Noise Ear Plugs come with high performance PU and Plast...

  CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.

  Jiangsu,China

  Active Member

  Add to cart

  Contact Supplier

• Adjustable Height Plastic Bracket Polycarbonate PC Sheet Canopy With Noise Reduction Rain Protection

  

  ...both plastic and aluminum, manufactured by our trusted Aluminum bracket factory to ensure the highest quality and durability. In addition to sun and rain protection, our DIY PC Canopy also has the added feat...

  Foshan Huaxia Nature Building Materials Co., Ltd.

  Guangdong,China

  Verified Supplier

  Add to cart

  Contact Supplier

• Black Wiring Harness Tape For Noise Reduction And Protection Against High Temperature Automotive Wiring Harness

  

  Company Profile *, *::before, *::after {box-sizing: border-box;}* {margin: 0;}html, body {height: 100%;}body {line-height: 1.5;-webkit-font-smoothing: antialiased;}img, picture, video, canvas, svg {display: blo...

  Dongguan Yihong Adhesive Technology Co., Ltd.

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

  

  ... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-HP-......

  Anhui Uniform Trading Co.Ltd

  Anhui,China

  Verified Supplier

  Add to cart

  Contact Supplier

• TWS Full Range Noise Reduction JL V40 In Ear Wireless Earphones

  

  ..., TWS smart headphones will play an important role in the fields of wireless connection, voice interaction, intelligent noise reduction, health monitoring, and hearing enhancement/protection. It is not only ...

  Shenzhen Hosing Technology Development Co., Ltd.

  Guangdong,China

  Verified Supplier

  Add to cart

  Contact Supplier

• Noise Reduction Electronic Ear Protection For Eyeglasses Outdoor

  

  ...noise reduction earmuffs, match the bluetooth music glasses are perfect group. When you listening to music, wear the noise reduction earmuffs, you will get music much more surround sound. It is perfect choic...

  Shenzhen HONY Optical Co., Limited

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• Soft Silicone Corded Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff

  

  ...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding...

  Sweet Home International(H.K.)Limited

  Zhejiang,China

  Active Member

  Add to cart

  Contact Supplier

• Leather Waterproof Headphone Ear Pads Thickness 2cm Noise Reduction

  

  ...Noise Reduction Product Description: Headphone Earpads provide excellent noise reduction and comfort for users. It comes with multi-color choice, such as black, to fit with different preferences. The round s...

  Dongguan Kerui Automation Technology Co., Ltd

  Guangdong,China

  Verified Supplier

  Add to cart

  Contact Supplier

• EM123 CE EN352 34dB ABS Shell Safety Earmuffs Effective Noise Reduction For Ears

  

  ... filter Earmuff NRR 31dB Size suit for adlut,easy to adjust Color Black,red,blue or others Function Reduce the noise to protect the ear MOQ 1000PCS Production capacity 100000pcs/month Packing one pc per poly...

  Ningbo Welwork Ppe Co., Ltd.

  Zhejiang,China

  Verified Supplier

  Add to cart

  Contact Supplier

• Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

  

  ...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...

  Earlisten Electronic Co ., Ltd

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

  

  ...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones ...

  Earlisten Electronic Co ., Ltd

  Guangdong,China

  Verified Supplier

  Add to cart

  Contact Supplier

• ANC true wireless waterproof sport earbuds wholesale 1562a wireless in ear TWS Noise Reduction Headset

  

  ... XY-50 TWS bluetooth earphone with charge case ear sensor earbuds bluetooth 3 pairs free ear tips freebuds ANC tws earbuds With a noise reduction depth of -28DB, it cut out the lower frequency noises like tr...

  SoKe Electronic Co.,Ltd

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• Split Audiophile Bluetooth Earbuds Noise Reduction Ipx5 Waterproof

  

  ... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active noise reduction Features Immersive sound Premium speaker drivers deliver crisp, dynamic audio. Active Noise Reduction Technology ...

  Anhui Arts & Crafts Import & Export Company Ltd.

  Anhui,China

  Verified Supplier

  Add to cart

  Contact Supplier

• Rechargeable Invisible Digital Hearing Amplifier With Noise Reduction

  

  ...Noise Reduction Super Effective Hearing Assist - Ideal for most mild to moderate hearing loss. With noise reduction, these small devices will bring you back in the clear world. Completely-in-Canal - Very sma...

  Retone shenzhen Technology Co., Ltd.

  China

  Active Member

  Add to cart

  Contact Supplier