Total 9827 products for noise proof ear plugs Manufacture & Suppliers

• Shipyard 33dB NRR Waterproof Noise Reduction Ear Plugs ANSI AS NZS

  

  ... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come wit...

  JIAXING FUXING IMP. AND EXP. CO.,LTD

  Zhejiang,China

  Active Member

  Add to cart

  Contact Supplier

• PU Plastic Soft Ear Plugs , Noise Reduction Ear Plugs Super Flexibility

  

  ..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc. The Noise Ear Plugs come with high performance PU and Plast...

  CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.

  Jiangsu,China

  Active Member

  Add to cart

  Contact Supplier

• Waterproof Safety Foam Ear Plugs 26.4dB 23.6inch 60cm Reusable Noise Cancelling Ear Plugs

  

  ... to break, reusable and can be cleaned. 6 Colors: The package contains 30 pairs of corded ear plugs in various colors including light blue, black, pink, green, orange and yellow, enough for your daily use; T...

  FUTURE TECH LIMITED

  China

  Verified Supplier

  Add to cart

  Contact Supplier

• E-1013 Bullet Type Sound Proof Ear Plugs For Sleeping Soft Resilient Material

  

  E-1013 Bullet Type Earplug For Good Sleeping Soft Resilient Material * Use: Improve sleep, concentrate on the spirit, protect hearing, etc. * Place: Can be used in homes, dormitories, classrooms, construction s...

  Shanghai Workplus Technology Co.,ltd

  Shanghai,China

  Active Member

  Add to cart

  Contact Supplier

• Flexible Shooting Ear Plugs ROHS Custom Silicone Parts

  

  ... use sealing characteristics of silicone material then designed to meet the human ear structure, a rubber ear plug can protect the eardrum by noise damage effectively. Silicone Ear Plugs are common used in e...

  Xiamen Juguangli Import & Export Co., Ltd

  Fujian,China

  Verified Supplier

  Add to cart

  Contact Supplier

• OEM Pyrex Glass Ear Plugs 13mm Stainless Steel Handmade Piercing Jewelry

  

  ... effect , handmade piercing jewelry , from 4 gauge to 1" , 13mm high , also can do other color Keywords: Ear Plug Tunnels OEM/ODM: Acceptable Piercing Plugs: Ear Plug Payment: T/T,Paypal Shipping Method: By ...

  Shenzhen Golden Moon Trade Ltd.

  China

  Active Member

  Add to cart

  Contact Supplier

• Soft Silicone Corded Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff

  

  ...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding...

  Sweet Home International(H.K.)Limited

  Zhejiang,China

  Active Member

  Add to cart

  Contact Supplier

• Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

  

  ... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-......

  Anhui Uniform Trading Co.Ltd

  Anhui,China

  Verified Supplier

  Add to cart

  Contact Supplier

• Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for Women

  

  Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for Women Product Description Product name Stud earrings Material Stainless steel Features Fine quality AAA Cubic Zirco...

  Guangzhou Pullman Jewelry Co., Ltd.

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• Pu Foam Ear Plugs

  

  Pu Foam Ear Plugs 【Description】 Sound insulation is made of PU foam, which is easy to put into your ear to keep away the noise. Each pair is packed with a easy-open plastic case. Your logo can be added on the c...

  Dishine International Limited

  Zhejiang,China

  Active Member

  Add to cart

  Contact Supplier

• Explosion Proof Power Plug and Socket 16A 32A 63A 220VAC Anti Corrosion 4 Pins

  

  ... where there is a risk of explosive gases and dust. This product has a protection level of IP66, which makes it an ideal solution for use in harsh environments. The Explosion Proof Plug and...

  crown extra lighting co. ltd

  Jiangsu,China

  Verified Supplier

  Add to cart

  Contact Supplier

• IP55 BJ-YT/GZ-4 Explosion Proof 4Phase Plugs And Sockets High Quality Made in China

  

  IP55 BJ-YT/GZ-4 Explosion Proof 4Phase Plugs And Sockets Product Description Explosion Proof Plug Socket Explosion proof plug and socket receptacles rated 60A, voltage 110V to 480V for use within hazardous area...

  Yueqing City DOWE Electric Co.，LTD

  Zhejiang,China

  Site Member

  Add to cart

  Contact Supplier

• Pu foam Ear plugs,Earplugs,Foam ear plugs ,CE EN 352-2 Bullet PU Foam Ear plugs

  

  Specifications -Foam earplug or silicone earplug -Metal tube with key ring,ball chain or hook. -Colour depends on need -Logo print is ok Description for earplug with metal tube: - Earplugs: PU foam earplug or s...

  YANGZHOU XINFLY AMENITIES CO.,LTD

  Jiangsu,China

  Active Member

  Add to cart

  Contact Supplier

• 300V 10A M2.5 Screw Fixed Ear Plug-In Brass Terminal Block

  

  HQ2EDGKM-5.0/5.08 mm pitch screw fixed ear plug-in type brass terminal block Pitch 5.0/5.08mm Screw M2.5.Steel.Zinc plated Wire guard Phosphor bronze.Ni plated Pin header Brass. Tin plated Rated voltage 300V Ra...

  CIXI ZHONGYI ELECTRONIC EQUIPMENT FACTORY

  Zhejiang,China

  Verified Supplier

  Add to cart

  Contact Supplier

• noise canceling ear cushion protein PU leather plus memory foam for the gaming headphone

  

  PRODUCT NAME : noise canceling ear cushion protein PU leather plus memory foam for the gaming headphone Item number :HR260519 Materials : high protein PU leather + memory foam colour : black /grey/red /orange/ ...

  LUCKY GREAT INDUSTRY (HONG KONG ) LIMITED

  Guangdong,China

  Site Member

  Add to cart

  Contact Supplier

• Sport ear plug Bluetooth earphone run headphone with hook best sellers in 2017

  

  ... plug, portability,steadiness and comfortable silica gal hook for ear. There are four fashion colors for choice,and the control buttons is on the right ear plug, this design will not be influence by the swea...

  Zhongshan Aomei Trade Co.,Ltd

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier

• The Most Affordable Option for Airline Travel Noise Cancelling Ear Earphone in Many Vibrant Colors

  

  Cheapest constellation in ear earphone with many colors Product Description Frequency 20-20,000 Hz Sensitivity 104±10%DB Impedance 32±2Ω Plug 3.5mm dual PIN Speaker 10mm Length 1.2m or customized Color multi Fu...

  Yichun Yuanzhou District Heshi Electronics Co., Ltd.

  China

  Verified Supplier

  Add to cart

  Contact Supplier

• Stereo Wireless blue tooth earphone earhook bone conduction headphones No Ear Plugs Headset

  

  ...bone conduction headphones No Ear Plugs Headset with Microphone TWS earbuds wireless earbuds wireless headset sport earphone Product description: Stereo Wireless blue tooth earphone earhook bone conduction h...

  Producentre (Dongguan) Electronic Co., Ltd

  Guangdong,China

  Active Member

  Add to cart

  Contact Supplier