| Sign In | Join Free | My burrillandco.com |
|
... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come wit...
..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc. The Noise Ear Plugs come with high performance PU and Plast...
... to break, reusable and can be cleaned. 6 Colors: The package contains 30 pairs of corded ear plugs in various colors including light blue, black, pink, green, orange and yellow, enough for your daily use; T...
... use sealing characteristics of silicone material then designed to meet the human ear structure, a rubber ear plug can protect the eardrum by noise damage effectively. Silicone Ear Plugs are common used in e...
... effect , handmade piercing jewelry , from 4 gauge to 1" , 13mm high , also can do other color Keywords: Ear Plug Tunnels OEM/ODM: Acceptable Piercing Plugs: Ear Plug Payment: T/T,Paypal Shipping Method: By ...
...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding...
HQ2EDGKM-5.0/5.08 mm pitch screw fixed ear plug-in type brass terminal block Pitch 5.0/5.08mm Screw M2.5.Steel.Zinc plated Wire guard Phosphor bronze.Ni plated Pin header Brass. Tin plated Rated voltage 300V Ra...
... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-......
... Waterproof & Noise Blocking Featuring a rotatable silicone wing structure: After inserting into the ear canal, twist the wings to create a 360° tight seal. It fully blocks pool/bath water from entering the ...
Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for Women Product Description Product name Stud earrings Material Stainless steel Features Fine quality AAA Cubic Zirco...
Pu Foam Ear Plugs 【Description】 Sound insulation is made of PU foam, which is easy to put into your ear to keep away the noise. Each pair is packed with a easy-open plastic case. Your logo can be added on the c...
Beats Studio 3 Wireless Headphones Blue Dr. Dre Bluetooth Noise Cancelling Ear Pure Adaptive Noise Canceling (Pure ANC) function actively blocks external noise Real-time audio calibration gives you the best sou...
1, Product Name: Sleep Eye Mask Cover with Ear Plugs, Light Blocking Memory Foam Eye Mask with Adjustable Strap for Sleeping/Shift Work ELIMINATE EYE FATIGUE: Unique contoured eliminate eye fatigue, which has...
Specifications -Foam earplug or silicone earplug -Metal tube with key ring,ball chain or hook. -Colour depends on need -Logo print is ok Description for earplug with metal tube: - Earplugs: PU foam earplug or s...
PRODUCT NAME : noise canceling ear cushion protein PU leather plus memory foam for the gaming headphone Item number :HR260519 Materials : high protein PU leather + memory foam colour : black /grey/red /orange/ ...
... plug, portability,steadiness and comfortable silica gal hook for ear. There are four fashion colors for choice,and the control buttons is on the right ear plug, this design will not be influence by the swea...